Myostatin (MSTN) (AA 267-375) antibody

Details for Product No. ABIN108525
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms GDF8, MSLHP, Cmpt, Gdf8, GDF-8, gdf8, mstn, zgc:109749, NV13143
Epitope
AA 267-375
(8), (8), (8), (6), (3), (2), (2), (2), (1), (1)
Reactivity
Human
(115), (51), (44), (42), (38), (24), (14), (2)
Host
Bovine
(77), (29), (27), (7), (2), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(13), (6), (4), (3), (3), (3), (3), (3), (3), (3), (3)
Application
Western Blotting (WB)
(103), (69), (36), (30), (27), (17), (8), (7), (2), (1), (1), (1)
Pubmed 3 references available
Catalog no. ABIN108525
Quantity 0.1 mg
Price
Contact our Customer Service for availability and price in your country.
Shipping to United States (Change)
Add to Basket

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen The antibody was raised in bovine by immunization with the recombinant Human Myostatin The immunization antigen (16.7 kDa) is a protein containing 152 AA of recombinant Human Myostatin. N-terminal His-tag including the spacer 43 AA (highlighted). The AA sequence of the human myostatin part of the fusion protein is corresponding to the UniProtKB/Swiss-Prot entry O14793, AA267-375
Sequence MRGSHHHHHHGMASMTGGQQ MGRDLYDDDDKDPSSRSAVRSRRDFGLDCDEHSTESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGECEFVFLQKYPHTHLVHQANPRGSAGPCCTPTKMSPINMLYFNGKEQIIYGKIPAMVVDRCGCS
Characteristics Source of Antigen: E. coli
Purification Immunoaffinity chromatography on a column with immobilized recombinant Human Myostatin
Alternative Name Myostatin
Background Myostatin (GDF 8) is expressed uniquely in human skeletal muscle as a 12 kDa mature glycoprotein consisting of 109 amino acid residues and secreted into plasma. Myostatin is a member of the transforming growth factor beta superfamily of secreted growth and differentiation factors that is essential for proper regulation of skeletal muscle mass. Studies have shown that myostatin could play an important role in cardiac development and physiology. In serum, myostatin circulates as part of a latent complex containing myostatin propeptide and/or follistatin-related gene. The myostatin propeptide is known to bind and inhibit myostatin in vitro. This interaction is relevant in vivo, with a majority (>70%) of myostatin in serum bound to its propeptide. The myostatin propeptide is negative regulator of myostatin in vivo
Research Area Hormones
Application Notes Titre: Is defined by indirect ELISA, it is >1/100,000 for antibody concentration 1mg/ml, 25 ng of antigen are coated per well, and is then defined at a point of maximal decrease of the titration curve.
Restrictions For Research Use only
Reconstitution Add 0.1 mL of deionized water and let the lyophilized pellet dissolve completely. Slight turbidity may occur after reconstitution, which does not affect activity of the antibody. In this case clarify the solution by centrifugation.
Buffer The antibody is lyophilized in 0.05 M phosphate buffer, 0.1 M NaCl, pH 7.2.
Preservative Without preservative
Storage -20 °C
Storage Comment The lyophilized antibody remains stable and fully active until the expiry date when stored at -20°C. Aliquot the product after reconstitution to avoid repeated freezing/thawing cycles and store frozen at -80°C. Reconstituted antibody can be stored at 4°C for a limited period of time; it does not show decline in activity after one week at 4°C.
General McPherron AC, Lee SJ: "Double muscling in cattle due to mutations in the myostatin gene." in: Proc Natl Acad Sci U S A, Vol. 94, Issue 23, pp. 12457-61, 1997 (PubMed).

Gonzalez-Cadavid NF, Taylor WE, Yarasheski K et al.: "Organization of the human myostatin gene and expression in healthy men and HIV-infected men with muscle wasting." in: Proc Natl Acad Sci U S A, Vol. 95, Issue 25, pp. 14938-43, 1998 (PubMed).

Sharma M, Kambadur R, Matthews KG et al.: "Myostatin, a transforming growth factor-beta superfamily member, is expressed in heart muscle and is upregulated in cardiomyocytes after infarct." in: J Cell Physiol, Vol. 180, Issue 1, pp. 1-9, 1999 (PubMed).

Hosts (77), (29), (27), (7), (2), (1)
Reactivities (115), (51), (44), (42), (38), (24), (14), (2)
Applications (103), (69), (36), (30), (27), (17), (8), (7), (2), (1), (1), (1)
Conjugates (13), (6), (4), (3), (3), (3), (3), (3), (3), (3), (3)
Epitopes (8), (8), (8), (6), (3), (2), (2), (2), (1), (1)
back to top