Did you know that you can buy products from over 140 different suppliers from us?

Abhydrolase Domain Containing 13 (ABHD13) (N-Term) antibody

Details for Product No. ABIN1105188
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BEM46L1, C13orf6, RP11-153I24.2, bA153I24.2, AI463703, AI788994, 1110065L07Rik, RGD1308317, zgc:123286
Epitope
N-Term
(3), (2)
Reactivity
Cow (Bovine), Chicken, Human, Mouse (Murine), Rat (Rattus), Xenopus laevis
(5), (3), (3), (3), (3), (3), (2)
Host
Rabbit
(7)
Clonality
Polyclonal
Application
Western Blotting (WB)
(7)
Pubmed 1 reference available
Quantity 50 µg
Shipping to United States (Change)
Availability Will be delivered in 6 to 8 Business Days
Catalog No. ABIN1105188
401.50 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ABHD13
Sequence SRLYVPMPTGIPHENIFIRTKDGIRLNLILIRYTGDNSPYSPTIIYFHGN
Specificity Western blots using two different antibodies against two unique regions of this protein target confirm the same apparent molecular weight in our tests.
Purification Immunoaffinity column
Alternative Name ABHD13
Background ABHD13 is a single-pass type II membrane protein. It belongs to the serine esterase family. The exact function of ABHD13 remains unknown.
Alternate names: Abhydrolase domain-containing protein 13, C13orf6
Gene ID 84945
NCBI Accession NP_116248
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C for one month or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Dunham, Matthews, Burton et al.: "The DNA sequence and analysis of human chromosome 13." in: Nature, Vol. 428, Issue 6982, pp. 522-8, 2004 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN1105188
401.50 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top