Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN1109284

Thymus High Mobility Group Box Protein (TOX) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 1700007F02Rik, TOX1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Cow (Bovine), Dog (Canine), Chicken, Human, Mouse (Murine), Rat (Rattus)
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN1109284
Quantity 50 µg
Price
390.50 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 6 to 8 Business Days
Immunogen The immunogen for anti-TOX antibody: synthetic peptide directed towards the N terminal of human TOX.
Sequence CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITP
Purification Purified using peptide immunoaffinity column
Alternative Name TOX
Background Some high-mobility group (HMG) box proteins (e.g., LEF1) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1) have multiple HMG boxes and bind DNA in a sequence-independent but structure- dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.Some high-mobility group (HMG) box proteins (e.g., LEF1) contain a single HMG box motif and bind DNA in a sequence-specific manner, while other members of this family (e.g., HMG1) have multiple HMG boxes and bind DNA in a sequence- independent but structure-dependent manner. All HMG box proteins are able to induce a sharp bend in DNA. TOX contains a single HMG box motif.[supplied by OMIM].
Alternate names: KIAA0808, Thymocyte selection-associated high mobility group box protein TOX, Thymus high mobility group box protein TOX
Gene ID 9760
NCBI Accession NP_055544
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water to a final concentration of 1 mg/mL.
Handling Advice Avoid repeated freezing and thawing.
Storage 4 °C/-20 °C
Storage Comment Store lyophilized at 2-8°C or at -20°C long term. After reconstitution store the antibody undiluted at 2-8°C for up to one month or in aliquots at -20°C long term.
Expiry Date 12 months
Background publications Aliahmad, OFlaherty, Han et al.: "TOX provides a link between calcineurin activation and CD8 lineage commitment." in: The Journal of experimental medicine, Vol. 199, Issue 8, pp. 1089-99, 2004 (PubMed).

Alternatives for antigen "Thymus High Mobility Group Box Protein (TOX)", type "Antibodies"
Hosts (9)
Reactivities (9), (1), (1), (1), (1), (1)
Applications (9), (5), (2), (1), (1)
Epitopes (7)
Beacon