Heme Oxygenase (Decycling) 1 (HMOX1) (AA 1-30) antibody

Details for Product No. ABIN137665, Supplier: Login to see New
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

AA 1-30
(43), (26), (21), (19), (14), (12), (11), (8), (5), (5), (5), (4), (3), (3), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
(230), (141), (118), (47), (31), (28), (27), (25), (24), (20), (5), (2), (2), (2)
(227), (76), (2), (1)
Clonality (Clone)
Monoclonal ()
(24), (20), (10), (9), (8), (8), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6), (6)
Flow Cytometry (FACS), Immunohistochemistry (IHC), Western Blotting (WB)
(283), (147), (124), (85), (79), (51), (38), (27), (19), (6), (3), (3), (1), (1)
Pubmed 3 references available
ProductDetails: Supplier Login to see New
ProductDetails: Supplier Product Number Login to see New
Quantity 50 μg
Shipping to United States ( )
Immunogen Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN, corresponding to amino acids 1-30 of Human Heme Oxygenase 1.
Clone HO-1-1
Isotype IgG1
Cross-Reactivity Mouse (Murine), Cow (Bovine), Dog (Canine), Rat (Rattus)
Purification Protein G purified.
Alternative Name Heme oxygenase 1 / HMOX1 (HMOX1 Antibody Abstract)
Background Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO1 and a constitutively expressed HO2. HO1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant.
Synonyms: Heme Oxygenase 1, 141250, 3162, HO1, Heme Oxygenase1, P09601, HO-1, HMOX1, bK286B10, HO 1
Application Notes Use at a concentration of 10

Positive Controls: Recombinant Human or Rat HO-1 (Hsp32) Protein

Restrictions For Research Use only
Format Liquid
Concentration 1 mg/mL
Buffer Phosphate-buffered saline containing 0.09% sodium azide and 50% glycerol
Preservative Sodium azide
Precaution of Use This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid freeze-thaw cycles.
Storage -20 °C
Storage Comment Upon receipt - Keep as concentrated solution. Aliquot and store at -20°C or below.
Supplier Images
Immunohistochemistry (IHC) image for anti-Heme Oxygenase (Decycling) 1 (HMOX1) (AA 1-30) antibody (ABIN137665) anti-Heme Oxygenase (Decycling) 1 (HMOX1) (AA 1-30) antibody
Western Blotting (WB) image for anti-Heme Oxygenase (Decycling) 1 (HMOX1) (AA 1-30) antibody (ABIN137665) anti-Heme Oxygenase (Decycling) 1 (HMOX1) (AA 1-30) antibody (Image 2)
Background publications Elbirt, Bonkovsky: "Heme oxygenase: recent advances in understanding its regulation and role." in: Proceedings of the Association of American Physicians, Vol. 111, Issue 5, pp. 438-47, 1999 (PubMed).

Foresti, Sarathchandra, Clark et al.: "Peroxynitrite induces haem oxygenase-1 in vascular endothelial cells: a link to apoptosis." in: The Biochemical journal, Vol. 339 ( Pt 3), pp. 729-36, 1999 (PubMed).

Yoshida, Biro, Cohen et al.: "Human heme oxygenase cDNA and induction of its mRNA by hemin." in: European journal of biochemistry / FEBS, Vol. 171, Issue 3, pp. 457-61, 1988 (PubMed).

Catalog No. ABIN137665
Contact our Customer Service for availability and price in your country.
Add to Basket

Order hotline:

  • +1 877 302 8632
  • +1 888 205 9894 (TF)
Did you look for something else?