You are viewing an incomplete version of our website. Please click to reload the website as full version.

Heme Oxygenase (Decycling) 1 (HMOX1) (AA 1-30) antibody

Details for Product No. ABIN137665, Supplier: Login to see
Antigen
  • HMOX1
  • HO1
  • MGC132176
  • wu:fc27c04
  • zgc:65984
  • ARABIDOPSIS THALIANA HEME OXYGENASE 1
  • ATHO1
  • F18A8.4
  • F18A8_4
  • GENOMES UNCOUPLED 2
  • GUN2
  • HEME OXYGENASE
  • HEME OXYGENASE 1
  • HEME OXYGENASE 6
  • HY1
  • HY6
  • PLASTID HEME OXYGENASE
  • REVERSAL OF THE DET PHENOTYPE 4
  • HMOX1D
  • HO-1
  • HSP32
  • bK286B10
  • D8Wsu38e
  • Hemox
  • Hmox
  • Hsp32
  • HEOXG
  • Heox
  • Ho-1
  • Ho1
  • hsp32
  • Hmox1
Epitope
AA 1-30
43
25
21
19
14
12
11
11
9
5
5
5
4
3
3
2
2
2
2
1
1
1
1
1
1
1
1
Reactivity
Human
250
159
138
46
30
28
26
24
23
19
3
2
2
2
Host
Mouse
232
89
2
1
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
22
20
11
10
9
9
7
7
7
7
7
7
7
7
7
7
7
Application
Flow Cytometry (FACS), Immunohistochemistry (IHC), Western Blotting (WB)
292
140
119
83
72
50
39
24
14
5
3
1
1
1
Supplier
Login to see
Supplier Product No.
Login to see
Request

Showcase your results, aid the scientific community, and receive a full refund.

Contribute a validation

Learn more

Available images

Immunogen Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN, corresponding to amino acids 1-30 of Human Heme Oxygenase 1.
Clone HO-1-1
Isotype IgG1
Cross-Reactivity Mouse (Murine), Cow (Bovine), Dog (Canine), Rat (Rattus)
Purification Protein G purified.
Alternative Name Heme oxygenase 1 / HMOX1 (HMOX1 Antibody Abstract)
Background Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO1 and a constitutively expressed HO2. HO1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant.
Synonyms: Heme Oxygenase 1, 141250, 3162, HO1, Heme Oxygenase1, P09601, HO-1, HMOX1, bK286B10, HO 1
Pathways
Application Notes Use at a concentration of 10
Comment

Positive Controls: Recombinant Human or Rat HO-1 (Hsp32) Protein

Restrictions For Research Use only
Format Liquid
Concentration 1 mg/mL
Buffer Phosphate-buffered saline containing 0.09% sodium azide and 50% glycerol
Preservative Sodium azide
Precaution of Use This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Handling Advice Avoid freeze-thaw cycles.
Storage -20 °C
Storage Comment Upon receipt - Keep as concentrated solution. Aliquot and store at -20°C or below.
Supplier Images
Immunohistochemistry (IHC) image for anti-Heme Oxygenase (Decycling) 1 (HMOX1) (AA 1-30) antibody (ABIN137665) anti-Heme Oxygenase (Decycling) 1 (HMOX1) (AA 1-30) antibody
Western Blotting (WB) image for anti-Heme Oxygenase (Decycling) 1 (HMOX1) (AA 1-30) antibody (ABIN137665) anti-Heme Oxygenase (Decycling) 1 (HMOX1) (AA 1-30) antibody (Image 2)
Background publications Elbirt, Bonkovsky: "Heme oxygenase: recent advances in understanding its regulation and role." in: Proceedings of the Association of American Physicians, Vol. 111, Issue 5, pp. 438-47, 1999 (PubMed).

Foresti, Sarathchandra, Clark et al.: "Peroxynitrite induces haem oxygenase-1 in vascular endothelial cells: a link to apoptosis." in: The Biochemical journal, Vol. 339 ( Pt 3), pp. 729-36, 1999 (PubMed).

Yoshida, Biro, Cohen et al.: "Human heme oxygenase cDNA and induction of its mRNA by hemin." in: European journal of biochemistry / FEBS, Vol. 171, Issue 3, pp. 457-61, 1988 (PubMed).