Did you know that you can buy products from over 140 different suppliers from us?

Heme Oxygenase (Decycling) 1 (HMOX1) antibody

Details for Product No. ABIN137665
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

HO1, HO-1, Hmox, Hemox, Hsp32, D8Wsu38e, Ho1, Heox, Ho-1, HEOXG, hsp32, Hmox1, HMOX1D, HSP32, bK286B10, HMOX1, MGC132176, wu:fc27c04, zgc:65984, ARABIDOPSIS THALIANA HEME OXYGENASE 1, ATHO1, F18A8.4,  ... show more
(125), (57), (42), (22), (22), (20), (14), (12), (5), (5), (5), (4), (2), (2)
(111), (49), (1)
(12), (10), (3), (3), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Flow Cytometry (FACS), Western Blotting (WB)
(143), (74), (66), (40), (37), (33), (17), (13), (10), (8), (3), (2), (1)
Pubmed 3 references available
Quantity 50 µg
Shipping to United States (Change)
Catalog No. ABIN137665
Contact our Customer Service for availability and price in your country.
Add to Basket

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide: MERPQPDSMPQDLSEALKEATKEVHTQAEN, corresponding to amino acids 1-30 of Human Heme Oxygenase 1.
Isotype IgG1
Cross-Reactivity Mouse (Murine), Rat (Rattus)
Purification Protein G affinity purified
Alternative Name Heme oxygenase 1 / HMOX1
Background Heme oxygenase (HO) is a microsomal enzyme that catalyzes the oxidation of heme to the antioxidant molecules, biliverdin and carbon monoxide. HO consists of two homologous isozymes, an inducible HO1 and a constitutively expressed HO2. HO1 is induced by a wide variety of stimuli including conditions of oxidative stress, inflammatory agents, transforming growth factor beta and heat shock. The increase in expression of HO1 is thought to be a cellular defense mechanism against oxidative stress since elevated HO could eventually generate more bilirubin, an anti-oxidant.
Application Notes Use at a concentration of 10
Restrictions For Research Use only
Format Liquid
Concentration Batch dependent within range: 0.80-1.00 mg/ml
Buffer 50% Glycerol, PBS, 0.1mM PMSF.
Preservative Sodium azide
Precaution of Use This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
General Yoshida, Biro, Cohen et al.: "Human heme oxygenase cDNA and induction of its mRNA by hemin." in: European journal of biochemistry / FEBS, Vol. 171, Issue 3, pp. 457-61, 1988 (PubMed).

Foresti, Sarathchandra, Clark et al.: "Peroxynitrite induces haem oxygenase-1 in vascular endothelial cells: a link to apoptosis." in: The Biochemical journal, Vol. 339 ( Pt 3), pp. 729-36, 1999 (PubMed).

Elbirt, Bonkovsky: "Heme oxygenase: recent advances in understanding its regulation and role." in: Proceedings of the Association of American Physicians, Vol. 111, Issue 5, pp. 438-47, 1999 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN137665
Contact our Customer Service for availability and price in your country.
Add to Basket

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top