ZNF83 antibody (N-Term)

Catalog No. ABIN1449869

Product Details anti-ZNF83 Antibody

Target: ZNF83 (Zinc Finger Protein 83 (ZNF83))

Binding Specificity: N-Term

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ZNF83 antibody is un-conjugated

Application: Western Blotting (WB)

Sequence: MHGRKDDAQKQPVKNQLGLNPQSHLPELQLFQAEGKIYKYDHMEKSVNSS

Cross-Reactivity (Details): Species reactivity (tested):Human

Purification: Peptide immunoaffinity column

Immunogen: A synthetic peptide directed towards the N-terminal region of human ZNF8

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Reconstitution: Add 50 μL of distilled water to a final concentration of 1.0 mg/mL.

Concentration: 1.0 mg/mL after reconstitution

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: Store lyophilized at 2-8 °C or at -20 °C long term. After reconstitution store the antibody undiluted at 2-8 °C for up to one month or (in aliquots) at -20 °C long term.

Target Details for ZNF83

Target: ZNF83 (Zinc Finger Protein 83 (ZNF83))

Alternative Name: ZNF83 (ZNF83 Products)

Synonyms: HPF1 antibody, ZNF816B antibody, zinc finger protein 83 antibody, ZNF83 antibody

Background: ZNF83 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 15 C2H2-type zinc fingers. ZNF83 may be involved in transcriptional regulation.Synonyms: HPF1, ZNF816B, Zinc finger protein 816B, Zinc finger protein 83, Zinc finger protein HPF1

Molecular Weight: 60 kDa (516 aa)

Gene ID: 55769

NCBI Accession: NP_001099019