lipase, gastric (LIPF) (Human) antibody

Overview


	Antigen:	Lipase, gastric (LIPF)
	Antibody Type:	Monoclonal
	Application:	ELISA, Western Blotting (WB)
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN167865
	Availability:	Delivery in 7 to 10 days

Antigen	Lipase, gastric (LIPF)
Gene ID	8513
Immunogen	LIPF (NP_004181, 299 a.a. ~ 399 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGL LLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK*
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG1 Kappa »Matching secondary antibodies
Description	Lipase, gastric Mouse monoclonal antibody raised against a partial recombinant LIPF. Synonyms: HGL, HLAL, MGC138477
Clone	200000000
Host	Mouse

Application	ELISA, Western Blotting (WB)
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.11 KDa) .

Image for lipase, gastric (LIPF) (Human) antibody (1)

The detection limit for recombinant GST tagged LIPF is approximately 0.03ng/ml as a capture antibody.

Image for lipase, gastric (LIPF) (Human) antibody (2)

Google Scholar	Find more references for clone 200000000 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen LIPF (Bioinformatic Harvester (EMBL))