SH2-B homolog (SH2B) (Human) antibody

Overview


	Antigen:	SH2-B homolog (SH2B)
	Antibody Type:	Monoclonal
	Application:	ELISA, Western Blotting (WB)
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN168705
	Availability:	Delivery in 7 to 10 days

Antigen	SH2-B homolog (SH2B)
Gene ID	25970
Immunogen	SH2B (AAH10704, 327 a.a. ~ 426 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) GKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVP SSQRQQGREQAGSHAGVCEGDGCHPDASCTLMPFGASDCVTDHLP
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG1 Kappa »Matching secondary antibodies
Description	SH2-B homolog Mouse monoclonal antibody raised against a partial recombinant SH2B. Synonyms: DKFZp547G1110, SH2-B
Clone	2B9
Host	Mouse

Application	ELISA, Western Blotting (WB)
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.00 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (37.00 KDa) .

Image for SH2-B homolog (SH2B) (Human) antibody (1)

The detection limit for recombinant GST tagged SH2B is approximately 0.03ng/ml as a capture antibody.

Image for SH2-B homolog (SH2B) (Human) antibody (2)

Google Scholar	Find more references for clone 2B9 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen SH2B (Bioinformatic Harvester (EMBL))