The page requested for Antigen "Yeast Cell Ag ( Saccharomyces cerevisiae)" could not be found. Please take a look at the alternatives listed below, or use the search form above to scan our full portfolio of more than 400.000 antibodies and related products. Thank you!
Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Endothelin Receptor Type A (EDNRA) antibody

Antigen

Endothelin Receptor Type A (EDNRA)

Synonyms ETA, ETAR, ETRA, ETa, ET-AR, Gpcr10, Eta, ENDOR, RATENDOR, ednr-a, wu:fb75g12, ednra, MGC52670, EDNRA, eta, etra, MGC145498
Clonality Polyclonal
Host
Alternatives

Mouse

Reactivity
Alternatives

Human

Application
Alternatives ELISA
Certificates ISO 9001:2008
Catalog no. ABIN170151
Quantity 50 µl  (Variants)
Price 260.00 $   Plus shipping costs $35.00 and if applicable $26.00 dry ice
Shipping to
Availability Ships within 5 to 10 Business Days

Additional Information

Gene ID 1909
Immunogen EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQ TKITSAFK
Description Endothelin receptor type A Mouse polyclonal antibody raised against a partial recombinant EDNRA. Synonyms: ETA, ETRA

Application Details

Application Notes Quality Control: Antibody Reactive Against Recombinant Protein on ELISA
Buffer In 50% Glycerol
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Alternatives

Alternatives for antigen "Endothelin Receptor Type A (EDNRA)", type "Antibodies"
Hosts Rabbit (28), Mouse (2), Sheep (2)
Reactivities Human (27), Mouse (Murine) (19), Rat (Rattus) (19)
Applications Immunofluorescence (IF) (17), Flow Cytometry (FACS) (15), Western Blotting (WB) (15), ELISA (7), Enzyme Immunoassay (EIA) (4), Immunohistochemistry (IHC) (4), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunoprecipitation (IP) (3), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Frozen Sections) (IHC (fro)) (2), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (EM) (1)
Conjugates Alexa Flour 488 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy7 (1), RBITC (1)
Epitopes C-Term (4), Center (1)