Product details for  endothelin receptor type A (EDNRA) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

endothelin receptor type A (EDNRA) (Human) antibody

Overview

Antigen: Endothelin receptor type A (EDNRA)
Antibody Type: Polyclonal
Application: ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN170151
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  endothelin receptor type A (EDNRA) (Human) antibody

back to top ^


Antigen Endothelin receptor type A (EDNRA)
Gene ID 1909
Immunogen EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQ TKITSAFK
Reactivity Human
Antibody Type Polyclonal
Description Endothelin receptor type A Mouse polyclonal antibody raised against a partial recombinant EDNRA. Synonyms: ETA, ETRA
Host Mouse

Application Details:  endothelin receptor type A (EDNRA) (Human) antibody

back to top ^


Application ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein on ELISA
Buffer In 50% Glycerol
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

External Information:  endothelin receptor type A (EDNRA) (Human) antibody

back to top ^


Google Scholar Find more references for antigen EDNRA on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen EDNRA (Bioinformatic Harvester (EMBL))