Product details for endothelin receptor type A (EDNRA) (Human) antibody
endothelin receptor type A (EDNRA) (Human) antibody
Overview
| Antigen: | Endothelin receptor type A (EDNRA) |
| Antibody Type: | Polyclonal |
| Application: | ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN170151 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: endothelin receptor type A (EDNRA) (Human) antibody
| Antigen | Endothelin receptor type A (EDNRA) |
| Gene ID | 1909 |
| Immunogen | EDNRA (AAH22511, 18 a.a. ~ 80 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VISDNPERYSTNLSNHVDDFTTFRGTELSFLVTTHQPTNLVLPSNGSMHNYCPQQ TKITSAFK |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | Endothelin receptor type A Mouse polyclonal antibody raised against a partial recombinant EDNRA. Synonyms: ETA, ETRA |
| Host | Mouse |
Application Details: endothelin receptor type A (EDNRA) (Human) antibody
| Application | ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein on ELISA |
| Buffer | In 50% Glycerol |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
External Information: endothelin receptor type A (EDNRA) (Human) antibody
| Google Scholar | Find more references for antigen EDNRA on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen EDNRA (Bioinformatic Harvester (EMBL)) |







