Product details for  interleukin 17 receptor B (IL17RB) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

interleukin 17 receptor B (IL17RB) (Human) antibody

Overview

Image for interleukin 17 receptor B (IL17RB) (Human) antibody
Antigen: Interleukin 17 receptor B (IL17RB)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN172664
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  interleukin 17 receptor B (IL17RB) (Human) antibody

back to top ^


Antigen Interleukin 17 receptor B (IL17RB)
Gene ID 55540
Immunogen IL17RB (NP_061195, 18 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) REPTVQCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVL RADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGG*
Reactivity Human
Antibody Type Polyclonal
Description Interleukin 17 receptor B The protein encoded by this gene is a cytokine receptor. This receptor specifically binds to IL17B and IL17E, but does not bind to IL17 and IL17C. This receptor has been shown to mediate the activation of NF-kappaB and the production of IL8 induced by IL17E. The expression of the rat counterpart of this gene was found to be significantly up-regulated during intestinal inflammation, which suggested the immunoregulatory activity of this receptor. Mouse polyclonal antibody raised against a partial recombinant IL17RB. Synonyms: CRL4, EVI27, IL17BR, IL17RH1, MGC5245
Host Mouse

Application Details:  interleukin 17 receptor B (IL17RB) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  interleukin 17 receptor B (IL17RB) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for interleukin 17 receptor B (IL17RB) (Human) antibody (1)

External Information:  interleukin 17 receptor B (IL17RB) (Human) antibody

back to top ^


Google Scholar Find more references for antigen IL17RB on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen IL17RB (Bioinformatic Harvester (EMBL))