Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182315

Zinc Finger and BTB Domain Containing 45 (ZBTB45) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZNF499, BB161562, Gm157, Zfp499, Znf499
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182315
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF499 antibody: synthetic peptide directed towards the middle region of human ZNF499
Sequence CEEPPAPTGLADYSGAGRDFLRGAGSAEDVFPDSYVSTWH DEDGAVPEGC
Predicted Reactivity Human :100%,   Rat :78%,   Dog :78%,   Mouse :78%,  
Characteristics This is a rabbit polyclonal antibody against ZNF499. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF499
Background The ZNF499 gene is located on chromosome 19 and encodes a protein with unknown function.
Molecular Weight 54kDa
Gene ID 84878
NCBI Accession NP_116181, NM_032792
UniProt Q96K62
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF499 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Zinc Finger and BTB Domain Containing 45 (ZBTB45)", type "Antibodies"
Hosts (7)
Reactivities (7), (3), (3), (3)
Applications (7), (3), (1)
Epitopes (3), (2)
Beacon