Did you know that you can buy products from over 140 different suppliers from us?

Homeobox D4 (HOXD4) (C-Term) antibody

Details for Product No. ABIN182355
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HOXD4, HHO.C13, HOX-5.1, HOX4, HOX4B, Hox-4.2, 6030436D05Rik, Hox-5.1, Chox-a
Epitope
C-Term
(12), (8), (2), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(17), (3), (1), (1), (1)
Host
Rabbit
(15), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(18), (9)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182355
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human HOXD4
Sequence RMKWKKDHKLPNTKGRSSSSSSSSSCSSSVAPSQHLQPMA KDHHTDLTTL
Predicted Reactivity Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Bovine : 90 %, Dog : 80 %
Characteristics This is a rabbit polyclonal antibody against HOXD4. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name HOXD4
Background HOXD4 belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined.This gene belongs to the homeobox family of genes. The homeobox genes encode a highly conserved family of transcription factors that play an important role in morphogenesis in all multicellular organisms. Mammals possess four similar homeobox gene clusters, HOXA, HOXB, HOXC and HOXD, located on different chromosomes, consisting of 9 to 11 genes arranged in tandem. This gene is one of several homeobox HOXD genes located at 2q31-2q37 chromosome regions. Deletions that removed the entire HOXD gene cluster or 5' end of this cluster have been associated with severe limb and genital abnormalities. The protein encoded by this gene may play a role in determining positional values in developing limb buds. Alternatively spliced variants have been described but their full length nature has not been determined.
Molecular Weight 28 kDa
Gene ID 3233
NCBI Accession NM_014621, NP_055436
UniProt P09016
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 255 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Homeobox D4 (HOXD4) (C-Term) antibody WB Suggested Anti-HOXD4 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Transfected 293T
Background publications Kosaki, Kosaki, Suzuki et al.: "Complete mutation analysis panel of the 39 human HOX genes." in: Teratology, Vol. 65, Issue 2, pp. 50-62, 2002 (PubMed).

Validation Images
back to top