General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (C-Term) antibody

Details for Product No. ABIN182365
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms gtf2f2, wu:fb39a05, zgc:86775, RAP30, btf4, gtf2f2.1, tf2f2, tfiif, BTF4, TF2F2, TFIIF, GTF2F2, Afu8g05490, An16g07220, AO090005000596
Epitope
C-Term
(9), (8), (4), (2), (2), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Xenopus laevis, Cow (Bovine), Zebrafish (Danio rerio), Human, Chicken
(23), (7), (7), (5), (3), (3), (3), (3)
Host
Rabbit
(21), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(23), (9), (5), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN182365
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human GTF2F2
Sequence KDLVDITKQPVVYLKEILKEIGVQNVKGIHKNTWELKPEY RHYQGEEKSD
Predicted Reactivity Dog : 100 %, Mouse : 90 %, Rat : 90 %, Zebrafish : 90 %, Chicken : 80 %
Characteristics This is a rabbit polyclonal antibody against GTF2F2. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name GTF2F2
Background GTF2F2 synergizes with HIV-1 Tat and the cellular coactivator Tat-SF1 during Tat-mediated transactivation of the HIV-1 LTR promoter. This gene is required for both basal and HIV-1 Tat-activated transcription.
Molecular Weight 28 kDa
Gene ID 2963
NCBI Accession NM_004128, NP_004119
UniProt P13984
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 249 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (C-Term) antibody WB Suggested Anti-GTF2F2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human Liver
anti-General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (C-Term) antibody (2) anti-General Transcription Factor IIF, Polypeptide 2, 30kDa (GTF2F2) (C-Term) antibody (Image 2)
Background publications Heng, Xiao, Shi et al.: "Genes encoding general initiation factors for RNA polymerase II transcription are dispersed in the human genome." in: Human molecular genetics, Vol. 3, Issue 1, pp. 61-4, 1994 (PubMed).

Hosts (21), (2)
Reactivities (23), (7), (7), (5), (3), (3), (3), (3)
Applications (23), (9), (5), (3), (2)
Conjugates (1), (1), (1), (1), (1), (1)
Epitopes (9), (8), (4), (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top