Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182373

Caudal Type Homeobox 2 (CDX2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CDX3, CDX-3, CDX-2, Cdx-2, CDX2, MGC130987, cdx3-like
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182373
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CDX2 antibody: synthetic peptide directed towards the middle region of human CDX2
Sequence QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLE LEKEFHYSRY
Predicted Reactivity Chicken : 100%, Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%
Characteristics This is a rabbit polyclonal antibody against CDX2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CDX2
Background CDX2 encodes a protein that plays an important role in gallbladder carcinogenesis with intestinal differentiation. Cdx2 is a highly sensitive marker for Barrett's esophagus.
Molecular Weight 34kDa
Gene ID 1045
NCBI Accession NP_001256, NM_001265
UniProt Q99626
Research Area Transcription Factors, Lineage Markers, CD Antigens, Surface Receptors of Immune Cells
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CDX2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Saad, Cho, Silverman et al.: "Usefulness of Cdx2 in separating mucinous bronchioloalveolar adenocarcinoma of the lung from metastatic mucinous colorectal adenocarcinoma." in: American journal of clinical pathology, Vol. 122, Issue 3, pp. 421-7, 2004 (PubMed).

Alternatives for antigen "Caudal Type Homeobox 2 (CDX2)", type "Antibodies"
Hosts (86), (20), (11)
Reactivities (110), (44), (42), (16), (14), (12), (12), (4), (2), (2)
Applications (72), (42), (35), (12), (10), (6), (6), (5), (5), (4), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (25), (12), (8), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1)
Beacon