Caudal Type Homeobox 2 (CDX2) (Middle Region) antibody

Details for Product No. ABIN182373
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CDX3, CDX-3, CDX-2, Cdx-2, CDX2, MGC130987, cdx3-like
Epitope
Middle Region
(21), (14), (10), (4), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Human, Chicken
(120), (51), (47), (16), (13), (12), (12), (9), (1), (1)
Host
Rabbit
(88), (27), (10)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(84), (49), (33), (15), (14), (10), (9), (5), (5), (4), (4), (3), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182373
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CDX2
Sequence QRRNLCEWMRKPAQQSLGSQVKTRTKDKYRVVYTDHQRLE LEKEFHYSRY
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %
Characteristics This is a rabbit polyclonal antibody against CDX2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CDX2
Background CDX2 encodes a protein that plays an important role in gallbladder carcinogenesis with intestinal differentiation. Cdx2 is a highly sensitive marker for Barrett's esophagus.
Molecular Weight 34 kDa
Gene ID 1045
NCBI Accession NM_001265, NP_001256
UniProt Q99626
Research Area Transcription Factors, Lineage Markers, CD Antigens, Surface Receptors of Immune Cells
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 313 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Caudal Type Homeobox 2 (CDX2) (Middle Region) antibody WB Suggested Anti-CDX2 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Human brain
Background publications Saad, Cho, Silverman et al.: "Usefulness of Cdx2 in separating mucinous bronchioloalveolar adenocarcinoma of the lung from metastatic mucinous colorectal adenocarcinoma." in: American journal of clinical pathology, Vol. 122, Issue 3, pp. 421-7, 2004 (PubMed).

Hosts (88), (27), (10)
Reactivities (120), (51), (47), (16), (13), (12), (12), (9), (1), (1)
Applications (84), (49), (33), (15), (14), (10), (9), (5), (5), (4), (4), (3), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (21), (14), (10), (4), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top