Lysine (K)-Specific Demethylase 2A (KDM2A) (N-Term) antibody

Details for Product No. ABIN182405
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms CXXC8, FBL11, FBL7, FBXL11, JHDM1A, LILINA, 100043628, 5530401A10Rik, AA589516, AW536790, Cxxc8, Fbl11, Fbl7, Fbxl11, Gm4560, Jhdm1, Jhdm1a, lalina
Epitope
N-Term
(5), (4), (2), (2)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Zebrafish (Danio rerio), Human
(33), (12), (12), (12), (12)
Host
Rabbit
(31), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(22), (13), (10), (8), (5), (3), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182405
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human FBXL11
Sequence RIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHT NKYNANFVTF
Predicted Reactivity Starlet sea anemone :100 %,   Pig :100 %,   Rat :100 %,   Mouse :100 %,   Green puffer :100 %,   Western clawed frog :100 %,   Human :100 %,   Florida lancelet :90 %,   Zebrafish :80 %,  
Characteristics This is a rabbit polyclonal antibody against FBXL11. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name FBXL11
Background FBXL11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box). The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL11 belongs to the Fbls class and, in addition to an F-box, contains at least 6 highly degenerated leucine-rich repeats
Molecular Weight 86 kDa
Gene ID 22992
NCBI Accession NM_001256405
UniProt Q9Y2K7-3
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 782 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Lysine (K)-Specific Demethylase 2A (KDM2A) (N-Term) antibody WB Suggested Anti-FBXL11 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
anti-Lysine (K)-Specific Demethylase 2A (KDM2A) (N-Term) antibody (2) anti-Lysine (K)-Specific Demethylase 2A (KDM2A) (N-Term) antibody (Image 2)
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Hosts (31), (3)
Reactivities (33), (12), (12), (12), (12)
Applications (22), (13), (10), (8), (5), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (2), (2)
back to top