Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182405

Lysine (K)-Specific Demethylase 2A (KDM2A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CXXC8, FBL11, FBL7, FBXL11, JHDM1A, LILINA, 100043628, 5530401A10Rik, AA589516, AW536790, Cxxc8, Fbl11, Fbl7, Fbxl11, Gm4560, Jhdm1, Jhdm1a, lalina
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Pig (Porcine), Zebrafish (Danio rerio), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182405
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FBXL11 antibody: synthetic peptide directed towards the N terminal of human FBXL11
Sequence RIRYSQRLRGTMRRRYEDDGISDDEIEGKRTFDLEEKLHT NKYNANFVTF
Predicted Reactivity Starlet sea anemone :100%,   Pig :100%,   Rat :100%,   Mouse :100%,   Green puffer :100%,   Western clawed frog :100%,   Human :100%,   Florida lancelet :90%,   Zebrafish :85%,  
Characteristics This is a rabbit polyclonal antibody against FBXL11. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name FBXL11
Background FBXL11 is a member of the F-box protein family which is characterized by an approximately 40 amino acid motif, the F-box. The F-box proteins constitute one of the four subunits of ubiquitin protein ligase complex called SCFs (SKP1-cullin-F-box). The F-box proteins are divided into 3 classes: Fbws containing WD-40 domains, Fbls containing leucine-rich repeats, and Fbxs containing either different protein-protein interaction modules or no recognizable motifs. FBXL11 belongs to the Fbls class and, in addition to an F-box, contains at least 6 highly degenerated leucine-rich repeats
Molecular Weight 86kDa
Gene ID 22992
NCBI Accession AAH47486, NM_001256405
UniProt Q9Y2K7-3
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FBXL11 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Lysine (K)-Specific Demethylase 2A (KDM2A)", type "Antibodies"
Hosts (37), (5)
Reactivities (41), (13), (13), (12), (12), (1), (1), (1)
Applications (29), (17), (10), (9), (7), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (5), (3), (2), (2), (2), (1), (1)
Beacon