Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182411

SEC14-Like 2 (S. Cerevisiae) (SEC14L2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C22orf6, SPF, TAP, TAP1, Spf, 1300013M05Rik, SEC14L2
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Pig (Porcine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182411
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SEC14L2 antibody: synthetic peptide directed towards the middle region of human SEC14L2
Sequence MTDPDGNPKCKSKINYGGDIPRKYYVRDQVKQQYEHSVQI SRGSSHQVEY
Predicted Reactivity Human : 100%, Horse : 93%, Pig : 93%, Mouse : 86%, Rat : 86%
Characteristics This is a rabbit polyclonal antibody against SEC14L2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SEC14L2
Background SEC14L2 encodes a cytosolic protein which belongs to a family of lipid-binding proteins including Sec14p, alpha-tocopherol transfer protein, and cellular retinol-binding protein. The encoded protein stimulates squalene monooxygenase which is a downstream enzyme in the cholesterol biosynthetic pathway.
Molecular Weight 46kDa
Gene ID 23541
NCBI Accession NP_036561, NM_012429
UniProt O76054
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SEC14L2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "SEC14-Like 2 (S. Cerevisiae) (SEC14L2)", type "Antibodies"
Hosts (19), (11)
Reactivities (28), (17), (12), (2), (1), (1), (1), (1), (1), (1)
Applications (20), (9), (5), (4), (4), (4), (2), (2)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (2), (2), (1), (1), (1)
Beacon