Pancreas Specific Transcription Factor, 1a (PTF1A) (N-Term) antibody

Details for Product No. ABIN182417
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms bHLHa29, PTF1-p48, PTF1p48, PTF1, si:zc142h2.2, zgc:112216, XPtf1a, Ptf1a/p48, PTF1A
Epitope
N-Term
(7), (4), (4), (3), (2), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Human
(43), (20), (17), (12), (12), (6), (5), (3)
Host
Rabbit
(34), (12), (8)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(35), (26), (10), (9), (5), (5), (2), (2), (2)
Pubmed 1 reference available
Catalog no. ABIN182417
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PTF1A
Sequence MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGD ELLADEQAEV
Predicted Reactivity Human : 100 %, African clawed frog : 90 %, Bovine : 90 %, Mouse : 90 %, Rat : 90 %, Zebrafish : 80 %, Dog : 80 %, Horse : 70 %
Characteristics This is a rabbit polyclonal antibody against PTF1A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PTF1A
Background PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas.
Molecular Weight 35 kDa
Gene ID 256297
NCBI Accession NM_178161, NP_835455
UniProt Q7RTS3
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Neurogenesis
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 328 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Pancreas Specific Transcription Factor, 1a (PTF1A) (N-Term) antibody WB Suggested Anti-PTF1A Antibody Titration: 2.5ug/ml
ELISA Titer: 1:312500
Positive Control: Jurkat cell lysate
Background publications McLellan, Langlands, Kealey: "Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening." in: Gene expression patterns : GEP, Vol. 2, Issue 3-4, pp. 329-35, 2003 (PubMed).

Hosts (34), (12), (8)
Reactivities (43), (20), (17), (12), (12), (6), (5), (3)
Applications (35), (26), (10), (9), (5), (5), (2), (2), (2)
Conjugates (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (4), (4), (3), (2), (2), (2), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top