Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182417

Pancreas Specific Transcription Factor, 1a (PTF1A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms bHLHa29, PTF1-p48, PTF1p48, PTF1, si:zc142h2.2, zgc:112216, XPtf1a, Ptf1a/p48, PTF1A
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Xenopus laevis, Zebrafish (Danio rerio), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182417
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A
Sequence MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGD ELLADEQAEV
Predicted Reactivity Human : 100%, African clawed frog : 92%, Bovine : 92%, Mouse : 92%, Rat : 92%, Zebrafish : 85%, Dog : 84%, Horse : 76%
Characteristics This is a rabbit polyclonal antibody against PTF1A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name PTF1A
Background PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas.
Molecular Weight 35kDa
Gene ID 256297
NCBI Accession NP_835455, NM_178161
UniProt Q7RTS3
Research Area Chromatin and Nuclear Signaling, Transcription Factors, Neurogenesis
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PTF1A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications McLellan, Langlands, Kealey: "Exhaustive identification of human class II basic helix-loop-helix proteins by virtual library screening." in: Gene expression patterns : GEP, Vol. 2, Issue 3-4, pp. 329-35, 2003 (PubMed).

Alternatives for antigen "Pancreas Specific Transcription Factor, 1a (PTF1A)", type "Antibodies"
Hosts (31), (14), (7)
Reactivities (42), (22), (18), (12), (12), (8), (3), (2), (1)
Applications (34), (26), (10), (8), (6), (3), (2), (1)
Conjugates (3), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (4), (4), (3), (3), (2), (1), (1), (1)
Beacon