Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182453

Hepatocyte Nuclear Factor 4, alpha (HNF4A) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
HNF4alpha, HNF-4alpha, HNF-4, Hnf4, Hnf4alpha, MODY1, Nr2a1, Tcf14, HNF4, HNF4a7, HNF4a8, HNF4a9, MODY, NR2A1, NR2A21, TCF, TCF14, fb58h09, id:ibd1279, wu:fb58h09, hnf4, nr2a1, HNF4A, CG9310, DmHNF4,  ... show more
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 2 references available
Catalog no. ABIN182453
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for Anti-HNF4A antibody is: synthetic peptide directed towards the N-terminal region of Human HNF4A
Sequence MRLSKTLVDMDMADYSAALDPAYTTLEFENVQVLTMGNDT SPSEGTNLNA
Predicted Reactivity Bovine : 100%, Chicken : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Sheep : 100%, Zebrafish : 92%, African clawed frog : 85%
Characteristics This is a rabbit polyclonal antibody against HNF4A. It was validated on Western Blot. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name HNF4A
Background The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants encoding several different isoforms.
Molecular Weight 53kDa
Gene ID 3172
NCBI Accession NP_000448, NM_000457
UniProt P41235
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final Anti-HNF4A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Weedon, Owen, Shields et al.: "Common variants of the hepatocyte nuclear factor-4alpha P2 promoter are associated with type 2 diabetes in the U.K. population." in: Diabetes, Vol. 53, Issue 11, pp. 3002-6, 2004 (PubMed).

Schmidt, Wilson, Ballester et al.: "Five-vertebrate ChIP-seq reveals the evolutionary dynamics of transcription factor binding." in: Science (New York, N.Y.), Vol. 328, Issue 5981, pp. 1036-40, 2010 (PubMed).

Alternatives for antigen "Hepatocyte Nuclear Factor 4, alpha (HNF4A)", type "Antibodies"
Hosts (89), (14), (7)
Reactivities (105), (57), (56), (28), (26), (25), (24), (4), (1), (1)
Applications (87), (50), (21), (20), (19), (16), (5), (4), (3), (2), (1), (1), (1)
Conjugates (2), (2), (2), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (19), (16), (10), (7), (5), (3), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon