GS Homeobox 2 (GSX2) (N-Term) antibody

Details for Product No. ABIN182507
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gsh2, Gsh-2, GSH2, GSHS, gsh2, zgc:136270, si:dkey-97c6.1
Epitope
N-Term
(4), (2), (2), (1), (1)
Reactivity
Dog (Canine), Mouse (Murine), Rat (Rattus), Human
(9), (2), (2), (2), (1)
Host
Rabbit
(7), (2)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(9), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182507
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human GSH2
Sequence MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPP LVMSVSGPGC
Predicted Reactivity Dog :100 %,   Human :100 %,   Rat :90 %,   Mouse :90 %,  
Characteristics This is a rabbit polyclonal antibody against GSH2. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name GSH2
Background Homeobox protein GSH-2
Molecular Weight 32 kDa
Gene ID 170825
NCBI Accession NM_133267, NP_573574
UniProt Q9BZM3
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 304 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-GS Homeobox 2 (GSX2) (N-Term) antibody Immunohistochemistry with Brain, cortex tissue at an antibody concentration of 5µg/ml using anti-GSH2 antibody (ARP32208_P050)
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (7), (2)
Reactivities (9), (2), (2), (2), (1)
Applications (9), (2), (1), (1)
Epitopes (4), (2), (2), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top