Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182507

GS Homeobox 2 (GSX2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Gsh2, Gsh-2, GSH2, GSHS, gsh2, zgc:136270, si:dkey-97c6.1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182507
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-GSH2 antibody: synthetic peptide directed towards the N terminal of human GSH2
Sequence MSRSFYVDSLIIKDTSRPAPSLPEPHPGPDFFIPLGMPPP LVMSVSGPGC
Predicted Reactivity Dog :100%,   Human :100%,   Rat :92%,   Mouse :92%,  
Characteristics This is a rabbit polyclonal antibody against GSH2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name GSH2
Background Homeobox protein GSH-2
Molecular Weight 32kDa
Gene ID 170825
NCBI Accession NP_573574, NM_133267
UniProt Q9BZM3
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-GSH2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "GS Homeobox 2 (GSX2)", type "Antibodies"
Hosts (7), (1)
Reactivities (8), (2), (2), (2), (1)
Applications (8), (2), (1)
Epitopes (5), (2), (2), (1), (1)
Beacon