Did you know that you can buy products from over 140 different suppliers from us?

E2F Transcription Factor 6 (E2F6) (Middle Region) antibody

Details for Product No. ABIN182510
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms E2F-6, AI462434, E2F6b, EMA
Epitope
Middle Region
(8), (5), (3), (3), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Human
(59), (34), (31), (2), (2)
Host
Rabbit
(45), (12), (3)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(45), (22), (14), (10), (8), (4), (4), (3), (3), (2)
Pubmed 2 references available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182510
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human E2F6
Sequence HEQIVIAVKAPAETRLDVPAPREDSITVHIRSTNGPIDVY LCEVEQGQTS
Predicted Reactivity Dog : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Bovine : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against E2F6. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name E2F6
Background E2F6 is a member of the E2F transcription factor protein family. E2F family members play a crucial role in control of the cell cycle and of the action of tumor suppressor proteins. They are also a target of the transforming proteins of small DNA tumor viruses. Many E2F proteins contain several evolutionarily conserved domains: a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. The encoded protein of this gene is atypical because it lacks the transactivation and tumor suppressor protein association domains. It contains a modular suppression domain and is an inhibitor of E2F-dependent transcription. The protein is part of a multimeric protein complex that contains a histone methyltransferase and the transcription factors Mga and Max. Multiple transcript variants encoding several different isoforms have been found for this gene.
Molecular Weight 14 kDa
Gene ID 1876
NCBI Accession NM_212540, NP_997705
UniProt Q6Q9Z5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 129 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-E2F Transcription Factor 6 (E2F6) (Middle Region) antibody anti-E2F Transcription Factor 6 (E2F6) (Middle Region) antibody
anti-E2F Transcription Factor 6 (E2F6) (Middle Region) antibody (2) Rabbit Anti-E2F6 Antibody ,Paraffin Embedded Tissue: Human Lung cell
Cellular Data: Epithelial cells of renal tubule
Antibody Concentration: 4.0-8.0 µg/mL
Magnification:.00X
Product cited in: Lazrek, Goffard, Schanen et al.: "Detection of hepatitis C virus antibodies and RNA among medicolegal autopsy cases in Northern France." in: Diagnostic microbiology and infectious disease, Vol. 55, Issue 1, pp. 55-8, 2006 (PubMed).

Background publications Talmud, Drenos, Shah et al.: "Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes." in: Genome research, Vol. 16, Issue 1, pp. 55-65, 2006 (PubMed).

Validation Images
back to top