Sirtuin 2 (SIRT2) (N-Term) antibody

Details for Product No. ABIN182551
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms SIR2, SIR2L, SIR2L2, Sir2l, 5730427M03Rik, zgc:55966, zgc:77003, wu:fb57d05, CG5085, D.mel2, Dmel\\CG5085, SIRT2, dSIRT2, sir2, Sirt2, BmSirt2, AtSRT2, SIRTUIN 2, T2K12.8, sirtuin 2
Epitope
N-Term
(25), (13), (5), (3), (2), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Human
(80), (56), (51), (4), (2), (2), (2), (1), (1), (1), (1)
Host
Rabbit
(86), (7)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(78), (49), (27), (18), (10), (6), (4), (3), (3), (3), (1), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182551
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SIRT2
Sequence MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDF LRNLFSQTLS
Predicted Reactivity Human : 100 %, Rabbit : 100 %, Bovine : 90 %, Horse : 90 %, Mouse : 90 %, Pig : 90 %, Rat : 90 %, Guinea pig : 80 %
Characteristics This is a rabbit polyclonal antibody against SIRT2. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name SIRT2
Background SIRT2 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by SIRT2 is included in class I of the sirtuin family.
Molecular Weight 43 kDa
Gene ID 22933
NCBI Accession NM_012237, NP_036369
UniProt Q8IXJ6
Research Area Chromatin and Nuclear Signaling, Cytoskeleton, Proteases
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 389 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Borra, Langer, Slama et al.: "Substrate specificity and kinetic mechanism of the Sir2 family of NAD+-dependent histone/protein deacetylases." in: Biochemistry, Vol. 43, Issue 30, pp. 9877-87, 2004 (PubMed).

Hosts (86), (7)
Reactivities (80), (56), (51), (4), (2), (2), (2), (1), (1), (1), (1)
Applications (78), (49), (27), (18), (10), (6), (4), (3), (3), (3), (1), (1), (1)
Conjugates (4), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (25), (13), (5), (3), (2), (1), (1), (1), (1), (1), (1), (1)
back to top