Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182551

Sirtuin 2 (SIRT2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SIR2, SIR2L, SIR2L2, Sir2l, 5730427M03Rik, zgc:55966, zgc:77003, wu:fb57d05, CG5085, D.mel2, Dmel\\CG5085, SIRT2, dSIRT2, sir2, Sirt2, BmSirt2, AtSRT2, SIRTUIN 2, T2K12.8, sirtuin 2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182551
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SIRT2 antibody: synthetic peptide directed towards the N terminal of human SIRT2
Sequence MAEPDPSHPLETQAGKVQEAQDSDSDSEGGAAGGEADMDF LRNLFSQTLS
Predicted Reactivity Human : 100%, Rabbit : 100%, Bovine : 92%, Horse : 92%, Mouse : 92%, Pig : 92%, Rat : 92%, Guinea pig : 84%
Characteristics This is a rabbit polyclonal antibody against SIRT2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name SIRT2
Background SIRT2 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by SIRT2 is included in class I of the sirtuin family.
Molecular Weight 43kDa
Gene ID 22933
NCBI Accession NP_036369, NM_012237
UniProt Q8IXJ6
Research Area Chromatin and Nuclear Signaling, Cytoskeleton, Proteases
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SIRT2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Borra, Langer, Slama et al.: "Substrate specificity and kinetic mechanism of the Sir2 family of NAD+-dependent histone/protein deacetylases." in: Biochemistry, Vol. 43, Issue 30, pp. 9877-87, 2004 (PubMed).

Alternatives for antigen "Sirtuin 2 (SIRT2)", type "Antibodies"
Hosts (83), (6)
Reactivities (76), (53), (47), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Applications (74), (43), (23), (16), (10), (9), (6), (3), (3), (2), (2), (1), (1), (1)
Conjugates (4), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (24), (11), (5), (3), (2), (1), (1), (1), (1), (1), (1)
Beacon