Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182559

Sirtuin 5 (SIRT5) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SIR2L5, AV001953, 0610012J09Rik, 1500032M05Rik, zgc:92288, sirt5-a, SIRT5, sir2l5
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Pig (Porcine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182559
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SIRT5 antibody: synthetic peptide directed towards the C terminal of human SIRT5
Sequence EVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAE FNTETTPATN
Predicted Reactivity Goat : 100%, Guinea pig : 100%, Human : 100%, Bovine : 92%, Dog : 92%, Mouse : 92%, Rat : 92%, Zebrafish : 90%, Chicken : 85%, Pig : 85%
Characteristics This is a rabbit polyclonal antibody against SIRT5. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name SIRT5
Background SIRT5 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in two transcript variants.
Molecular Weight 32kDa
Gene ID 23408
NCBI Accession NP_112534, NM_031244
UniProt Q9NXA8
Research Area Chromatin and Nuclear Signaling, Proteases
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SIRT5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Frye: "Phylogenetic classification of prokaryotic and eukaryotic Sir2-like proteins." in: Biochemical and biophysical research communications, Vol. 273, Issue 2, pp. 793-8, 2000 (PubMed).

Alternatives for antigen "Sirtuin 5 (SIRT5)", type "Antibodies"
Hosts (59), (22), (9), (1)
Reactivities (78), (32), (26), (3), (2), (1), (1)
Applications (76), (30), (16), (16), (12), (12), (10), (4), (4), (2), (1)
Conjugates (7), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (15), (4), (3), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon