Sirtuin 5 (SIRT5) (C-Term) antibody

Details for Product No. ABIN182559
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms SIR2L5, AV001953, 0610012J09Rik, 1500032M05Rik, zgc:92288, sirt5-a, SIRT5, sir2l5
Epitope
C-Term
(15), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Zebrafish (Danio rerio), Xenopus laevis, Pig (Porcine), Human, Chicken
(77), (34), (26), (3), (2), (1), (1)
Host
Rabbit
(57), (24), (8), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(7), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(76), (32), (19), (16), (14), (12), (10), (6), (4), (3), (2)
Pubmed 1 reference available
Catalog no. ABIN182559
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human SIRT5
Sequence EVDRELAHCDLCLVVGTSSVVYPAAMFAPQVAARGVPVAE FNTETTPATN
Predicted Reactivity Goat : 100 %, Guinea pig : 100 %, Human : 100 %, Bovine : 90 %, Dog : 90 %, Mouse : 90 %, Rat : 90 %, Zebrafish : 90 %, Chicken : 80 %, Pig : 80 %
Characteristics This is a rabbit polyclonal antibody against SIRT5. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name SIRT5
Background SIRT5 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined, however, yeast sirtuin proteins are known to regulate epigenetic gene silencing and suppress recombination of rDNA. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by this gene is included in class III of the sirtuin family. Alternative splicing of this gene results in two transcript variants.
Molecular Weight 32 kDa
Gene ID 23408
NCBI Accession NM_031244, NP_112534
UniProt Q9NXA8
Research Area Chromatin and Nuclear Signaling, Proteases
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 299 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Sirtuin 5 (SIRT5) (C-Term) antibody WB Suggested Anti-SIRT5 Antibody Titration: 0.2-1 ug/ml
Positive Control: HepG2 cell lysate
anti-Sirtuin 5 (SIRT5) (C-Term) antibody (2) anti-Sirtuin 5 (SIRT5) (C-Term) antibody (Image 2)
anti-Sirtuin 5 (SIRT5) (C-Term) antibody (3) anti-Sirtuin 5 (SIRT5) (C-Term) antibody (Image 3)
Background publications Frye: "Phylogenetic classification of prokaryotic and eukaryotic Sir2-like proteins." in: Biochemical and biophysical research communications, Vol. 273, Issue 2, pp. 793-8, 2000 (PubMed).

Hosts (57), (24), (8), (1)
Reactivities (77), (34), (26), (3), (2), (1), (1)
Applications (76), (32), (19), (16), (14), (12), (10), (6), (4), (3), (2)
Conjugates (7), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (15), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1)
back to top