Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182566

Sirtuin 6 (SIRT6) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Sir2l6, AI043036, 2810449N18Rik, SIR2L6
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Pig (Porcine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182566
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SIRT6 antibody: synthetic peptide directed towards the N terminal of human SIRT6
Sequence STASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTH MALVQLERVG
Predicted Reactivity Dog : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Bovine : 92%, Guinea pig : 92%, Horse : 92%, Rat : 92%, African clawed frog : 84%, Chicken : 84%
Characteristics This is a rabbit polyclonal antibody against SIRT6. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name SIRT6
Background SIRT6 encodes a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Studies suggest that the human sirtuins may function as intracellular regulatory proteins with mono-ADP-ribosyltransferase activity. The protein encoded by SIRT6 is included in class IV of the sirtuin family.
Molecular Weight 39kDa
Gene ID 51548
NCBI Accession NP_057623, NM_016539
UniProt Q8N6T7
Research Area Cancer
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SIRT6 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Frye: "Phylogenetic classification of prokaryotic and eukaryotic Sir2-like proteins." in: Biochemical and biophysical research communications, Vol. 273, Issue 2, pp. 793-8, 2000 (PubMed).

Alternatives for antigen "Sirtuin 6 (SIRT6)", type "Antibodies"
Hosts (105), (9), (8)
Reactivities (103), (41), (27), (3), (1)
Applications (94), (40), (24), (20), (20), (9), (6), (6), (2), (1), (1), (1)
Conjugates (14), (8), (6), (4), (3), (3), (2), (2), (2), (2), (2), (2), (2), (2)
Epitopes (32), (12), (8), (7), (7), (6), (3), (3), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1)
Beacon