Did you know that you can buy products from over 140 different suppliers from us?

Orthodenticle Homeobox 2 (OTX2) (N-Term) antibody

Details for Product No. ABIN182571
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CPHD6, MCOPS5, Xotx-2, Xotx2, otx-2, otx2, id:ibd2915, zOtx2, zgc:136535, zotx-2, E130306E05Rik
Epitope
N-Term
(9), (2), (2), (1), (1), (1), (1)
Reactivity
Rabbit, Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
(50), (18), (17), (14), (14), (14), (2), (2), (1), (1), (1)
Host
Rabbit
(35), (16), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(42), (25), (24), (14), (10), (8), (7), (5), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182571
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human OTX2
Sequence PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSP AREVSSESGT
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, Rat : 100 %, Sheep : 100 %, Zebrafish : 100 %, African clawed frog : 90 %
Characteristics This is a rabbit polyclonal antibody against OTX2. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name OTX2
Background Homeobox protein OTX2 is a member of the bicoid sub-family of homeodomain-containing transcription factors. This protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined. This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined.
Molecular Weight 32 kDa
Gene ID 5015
NCBI Accession NM_021728, NP_068374
UniProt P32243-2
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 297 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Orthodenticle Homeobox 2 (OTX2) (N-Term) antibody WB Suggested Anti-OTX2 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
anti-Orthodenticle Homeobox 2 (OTX2) (N-Term) antibody (2) anti-Orthodenticle Homeobox 2 (OTX2) (N-Term) antibody (Image 2)
anti-Orthodenticle Homeobox 2 (OTX2) (N-Term) antibody (3) anti-Orthodenticle Homeobox 2 (OTX2) (N-Term) antibody (Image 3)
anti-Orthodenticle Homeobox 2 (OTX2) (N-Term) antibody (4) Host: Rabbit
Target Name: OTX2
Sample Tissue: Hela
Antibody Dilution: 1.0 µg/mL
anti-Orthodenticle Homeobox 2 (OTX2) (N-Term) antibody (5) Host: Rabbit
Target Name: OTX2
Sample Tissue: HepG2
Antibody Dilution: 1.0 µg/mL
anti-Orthodenticle Homeobox 2 (OTX2) (N-Term) antibody (6) Host: Rabbit
Target Name: OTX2
Sample Tissue: Human Fetal Muscle
Antibody Dilution: 1.0 µg/mL
anti-Orthodenticle Homeobox 2 (OTX2) (N-Term) antibody (7) Host: Rabbit
Target Name: OTX2
Sample Tissue: Jurkat
Antibody Dilution: 1.0 µg/mL
anti-Orthodenticle Homeobox 2 (OTX2) (N-Term) antibody (8) Host: Rabbit
Target Name: OTX2
Sample Tissue: MCF7
Antibody Dilution: 1.0 µg/mL
Product cited in: Takeda, Yokoyama, Yasumoto et al.: "OTX2 regulates expression of DOPAchrome tautomerase in human retinal pigment epithelium." in: Biochemical and biophysical research communications, Vol. 300, Issue 4, pp. 908-14, 2003 (PubMed).

Validation Images
back to top