Did you know that you can buy products from over 140 different suppliers from us?

Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14) (N-Term) antibody

Details for Product No. ABIN182576
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PAD1, POH1, RPN11, 2610312C03Rik, 3200001M20Rik, AA986732, Pad1, Poh1, rpm11, zgc:162272, 37B, CG18174, DmS13, Dmel\\CG18174, RPn11, S13, p37B, rpn11, yip5
Epitope
N-Term
(12), (9), (7), (6), (3), (2), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human, Chicken
(66), (23), (23), (15), (5), (4), (3), (3), (2), (1), (1), (1)
Host
Rabbit
(48), (21)
Clonality
Polyclonal
Conjugate
Un-conjugated
(4), (4), (4), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(43), (32), (14), (10), (10), (8), (4), (4), (2), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182576
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PSMD14
Sequence MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLK MLKHGRAGVP
Predicted Reactivity African clawed frog : 100 %, Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Pig : 100 %, Rabbit : 100 %, Rat : 100 %, Zebrafish : 100 %
Characteristics This is a rabbit polyclonal antibody against PSMD14. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PSMD14
Background POH1 (pad one homolog-1) is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway (Spataro et al., 1997 [PubMed 9374539]).
Molecular Weight 35 kDa
Gene ID 10213
NCBI Accession NM_005805, NP_005796
UniProt O00487
Research Area Proteolysis / Ubiquitin, Proteasome
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 310 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14) (N-Term) antibody WB Suggested Anti-PSMD14 Antibody Titration: 1.25ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysate
Background publications Spataro, Toda, Craig et al.: "Resistance to diverse drugs and ultraviolet light conferred by overexpression of a novel human 26 S proteasome subunit." in: The Journal of biological chemistry, Vol. 272, Issue 48, pp. 30470-5, 1997 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182576
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top