Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182576

Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PAD1, POH1, RPN11, 2610312C03Rik, 3200001M20Rik, AA986732, Pad1, Poh1, rpm11, zgc:162272, 37B, CG18174, DmS13, Dmel\\CG18174, RPn11, S13, p37B, rpn11, yip5
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Xenopus laevis, Cow (Bovine), Fruit Fly (Drosophila melanogaster), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182576
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PSMD14 antibody: synthetic peptide directed towards the N terminal of human PSMD14
Sequence MDRLLRLGGGMPGLGQGPPTDAPAVDTAEQVYISSLALLK MLKHGRAGVP
Predicted Reactivity African clawed frog : 100%, Bovine : 100%, Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rabbit : 100%, Rat : 100%, Zebrafish : 100%
Characteristics This is a rabbit polyclonal antibody against PSMD14. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name PSMD14
Background POH1 (pad one homolog-1) is a component of the 26S proteasome, a multiprotein complex that degrades proteins targeted for destruction by the ubiquitin pathway (Spataro et al., 1997 [PubMed 9374539]).
Molecular Weight 35kDa
Gene ID 10213
NCBI Accession NP_005796, NM_005805
UniProt O00487
Research Area Proteolysis / Ubiquitin, Proteasome
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PSMD14 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Spataro, Toda, Craig et al.: "Resistance to diverse drugs and ultraviolet light conferred by overexpression of a novel human 26 S proteasome subunit." in: The Journal of biological chemistry, Vol. 272, Issue 48, pp. 30470-5, 1997 (PubMed).

Alternatives for antigen "Proteasome (Prosome, Macropain) 26S Subunit, Non-ATPase, 14 (PSMD14)", type "Antibodies"
Hosts (40), (14)
Reactivities (51), (21), (21), (15), (5), (4), (3), (3), (2), (1), (1), (1)
Applications (28), (20), (10), (10), (6), (4), (4), (4), (1), (1)
Conjugates (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (7), (3), (2), (2), (1), (1), (1), (1), (1)
Beacon