Zinc Finger Protein 36, C3H Type, Homolog (Mouse) (ZFP36) antibody
| Antigen | Zinc Finger Protein 36, C3H Type, Homolog (Mouse) (ZFP36) |
| Synonyms | TTP, G0S24, GOS24, TIS11, NUP475, RNF162A, ttp, c3h-1, g0s24, gos24, tis11, nup475, rnf162a, MGC83426, MGC132279, ZFP36, MGC140545, C3H-1 |
| Clonality | Polyclonal |
| Host |
 Alternatives Rabbit |
| Reactivity |
Alternatives Human |
| Application |
Alternatives Western Blotting (WB) |
 |
1 reference available |
| Catalog no. | ABIN182700 |
| Quantity | 50 µg (Variants) |
| Price | 317.90 $ Plus shipping costs $45.00 |
| Shipping to |
|
| Availability | Will be delivered in 2 to 3 Business Days |
Additional Information
| Alternative name | Tristetraproline (TTP) |
| Gene ID | HSZFP36 |
| UniProt | Q6P4A9 |
| Immunogen | The immunogen for anti-HSZFP36 antibody: synthetic peptide directed towards the middle region of human HSZFP36 |
| Sequence | GKAFSLAGSLRRHEATHTGVKPYKCQCGKAFSDLSSFQNH ETTHTGEKPY |
| Cross-Reactivity | Human |
| Format | Lyophilized |
| Reconstitution | Add 50 µl of distilled water. Final anti-HSZFP36 antibody concentration is 1 mg/ml. |
| Description | CDNA sequence of HSZFP36 is generated by Mammalian Gene Collection (MGC) Program Team. |
| Characteristics | Antigen Size: 397 amino acids |
| Molecular Weight | 44kDa |
Application Details
| Application Notes |
WB Suggested Anti-HSZFP36 Antibody Titration: 0.2-1 ug/ml Positive Control: Human Liver. |
| Purification | Affinity Purified |
| Buffer | PBS |
| Storage (Long Term) | For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles. |
| Storage (Short Term) | Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen. |
| Restrictions | For Research Use only |
Publications
| Product |
Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).
|
Alternatives
Alternatives for antigen "Zinc Finger Protein 36, C3H Type, Homolog (Mouse) (ZFP36)", type "Antibodies"
| Hosts | Rabbit (17), Mouse (12) |
| Reactivities | Human (29), Mouse (Murine) (7), Rat (Rattus) (7), Dog (Canine) (5), Cow (Bovine) (4), Chicken (3), Pig (Porcine) (3), Xenopus laevis (2), Zebrafish (2), Cat (Feline) (1), Monkey (1) |
| Applications | Western Blotting (WB) (27), Flow Cytometry (FACS) (12), ELISA (9), Immunofluorescence (IF) (8), Immunohistochemistry (IHC) (8), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (3), Immunoprecipitation (IP) (1) |
| Epitopes | Center (2), Internal Region (2), N-Term (2) |
Sponsorship
2013 BioMed Central Research Awards
2013 BioMed Central Research Awards
