Did you know that you can buy products from over 140 different suppliers from us?

DNA Methyltransferase 1-Associated Protein 1 (DMAP1) (N-Term) antibody

Details for Product No. ABIN182710
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms DNMAP1, DNMTAP1, EAF2, MEAF2, SWC4, Dmtap1, mKIAA1425, 1500016M21Rik, zgc:55593, dnmap1, dnmtap1, eaf2, meaf2, swc4, Afu4g07380, T8I13.5
Epitope
N-Term
(4), (3), (3), (2), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Dog (Canine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human, Chicken
(45), (21), (17), (14), (14), (12), (3), (1)
Host
Rabbit
(29), (11), (6)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(32), (16), (10), (8), (2), (2), (2), (1), (1), (1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182710
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human DMAP1
Sequence DAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVE DLKERYYHIC
Predicted Reactivity Bovine : 100 %, Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Mouse : 100 %, Rabbit : 100 %, African clawed frog : 90 %, Rat : 90 %, Zebrafish : 80 %
Characteristics This is a rabbit polyclonal antibody against DMAP1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name DMAP1
Background DMAP1 is a subunit of several, distinct complexes involved in the repression or activation of transcription. The encoded protein can independently repress transcription and is targeted to replication foci throughout S phase by interacting directly with the N-terminus of DNA methyltransferase 1. During late S phase, histone deacetylase 2 is added to this complex, providing a means to deacetylate histones in transcriptionally inactive heterochromatin following replication. The encoded protein is also a component of the nucleosome acetyltransferase of H4 complex and interacts with the transcriptional corepressor tumor susceptibility gene 101 and the pro-apoptotic death-associated protein 6, among others. Alternatively spliced transcript variants encoding the same protein have been described.
Molecular Weight 51 kDa
Gene ID 55929
NCBI Accession NM_001034024, NP_001029196
UniProt Q9NPF5
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 467 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-DNA Methyltransferase 1-Associated Protein 1 (DMAP1) (N-Term) antibody WB Suggested Anti-DMAP1 Antibody Titration: 1.25ug/ml
Positive Control: HepG2 cell lysate
Background publications Oh, Yang, Hahn et al.: "Transcriptome analysis of human gastric cancer." in: Mammalian genome : official journal of the International Mammalian Genome Society, Vol. 16, Issue 12, pp. 942-54, 2005 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182710
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top