Did you know that you can buy products from over 140 different suppliers from us?

Retinoblastoma 1 (RB1) (C-Term) antibody

Details for Product No. ABIN182758
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RB1, OSRC, RB, p105-Rb, pRb, pp110, Rb, Rb-1, zgc:154147, P105-RB, PP110, RB11
Epitope
C-Term
(32), (31), (28), (21), (19), (19), (17), (17), (17), (14), (11), (5), (5), (3), (2), (2), (2), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Zebrafish (Danio rerio), Dog (Canine), Cow (Bovine), Human, Chicken
(339), (226), (214), (108), (84), (64), (48), (7), (1), (1)
Host
Rabbit
(298), (54), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(10), (10), (10), (10), (10), (10), (10), (10), (10), (10), (10)
Application
Western Blotting (WB)
(212), (100), (94), (88), (80), (34), (31), (18), (11), (7), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182758
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human RB1
Sequence IMMCSMYGICKVKNIDLKFKIIVTAYKDLPHAVQETFKRV LIKEEEYDSI
Predicted Reactivity Bovine : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Mouse : 90 %
Characteristics This is a rabbit polyclonal antibody against RB1. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name RB1
Background Retinoblastoma (RB) is an embryonic malignant neoplasm of retinal origin. It almost always presents in early childhood and is often bilateral. Spontaneous regression ('cure') occurs in some cases.
Molecular Weight 106 kDa
Gene ID 5925
NCBI Accession NM_000321, NP_000312
UniProt P06400
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 928 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Retinoblastoma 1 (RB1) (C-Term) antibody WB Suggested Anti-RB1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: Daudi cell lysate
Background publications Dasgupta, Sun, Wang et al.: "Disruption of the Rb--Raf-1 interaction inhibits tumor growth and angiogenesis." in: Molecular and cellular biology, Vol. 24, Issue 21, pp. 9527-41, 2004 (PubMed).

Validation Images
back to top