Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182774

Zinc Finger and SCAN Domain Containing 18 (ZSCAN18) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RGD1560671, ZNF447, EG232875
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182774
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF447 antibody: synthetic peptide directed towards the N terminal of human ZNF447
Sequence PADLEFSRLRFREFVYQEAAGPHQTLARLHELCRQWLMPE ARSKEQMLEL
Predicted Reactivity Rat :100%,   Human :100%,   Dog :84%,  
Characteristics This is a rabbit polyclonal antibody against ZNF447. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZNF447
Background ZNF447 contains 1 SCAN box domain and 2 C2H2-type zinc fingers. It belongs to the kruppel C2H2-type zinc-finger protein family and may be involved in transcriptional regulation.
Molecular Weight 55kDa
Gene ID 65982
NCBI Accession NP_076415, NM_023926
UniProt Q8TBC5
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF447 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Zinc Finger and SCAN Domain Containing 18 (ZSCAN18)", type "Antibodies"
Hosts (9), (8)
Reactivities (17), (1), (1)
Applications (16), (5), (4), (2), (2), (1)
Epitopes (3), (2), (2), (2), (1), (1), (1)
Beacon