Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182793

ZFP36 Ring Finger Protein-Like 1 (ZFP36L1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Berg36, Brf1, ERF1, TIS11b, cMG1, ZFP36L1, berg36, brf1, c3h-2, cmg1, erf-1, erf1, rnf162b, tis11b, BRF1, ERF-1, TIS11B, RNF162B, AW742437, AW743212, D530020L18Rik
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182793
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZFP36L1 antibody: synthetic peptide directed towards the N terminal of human ZFP36L1
Sequence GGGFPRRHSVTLPSSKFHQNQLLSSLKGEPAPALSSRDSR FRDRSFSEGG
Predicted Reactivity Bovine : 100%, Dog : 100%, Guinea pig : 100%, Human : 100%, Mouse : 100%, Pig : 100%, Rat : 100%, African clawed frog : 76%
Characteristics This is a rabbit polyclonal antibody against ZFP36L1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZFP36L1
Background ZFP36L1 is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.This gene is a member of the TIS11 family of early response genes. Family members are induced by various agonists such as the phorbol ester TPA and the polypeptide mitogen EGF. The gene is well conserved across species and has a promoter that contains motifs seen in other early-response genes. The encoded protein contains a distinguishing putative zinc finger domain with a repeating cys-his motif. This putative nuclear transcription factor most likely functions in regulating the response to growth factors.
Molecular Weight 36kDa
Gene ID 677
NCBI Accession NP_004917, NM_004926
UniProt Q07352
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZFP36L1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rual, Venkatesan, Hao et al.: "Towards a proteome-scale map of the human protein-protein interaction network." in: Nature, Vol. 437, Issue 7062, pp. 1173-8, 2005 (PubMed).

Alternatives for antigen "ZFP36 Ring Finger Protein-Like 1 (ZFP36L1)", type "Antibodies"
Hosts (64), (8)
Reactivities (71), (49), (43), (39), (37), (27), (12), (1)
Applications (42), (30), (24), (11), (7), (5), (3), (3), (1)
Conjugates (3), (3), (3), (3), (3), (3), (3), (3), (3), (3), (3)
Epitopes (13), (13), (13), (3), (3), (2), (2), (1), (1)
Beacon