Zinc Finger Protein 426 (ZNF426) (N-Term) antibody

Details for Product No. ABIN182834
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 2900057C04Rik, KRAB1, Zfo61, Zfp68-rs1, Znf426, mKIAA4237, RGD1564241, Zfp426l2, Znf846, ZNF426, MGC156802
Epitope
N-Term
(5), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(23), (15), (15)
Host
Rabbit
(22), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(13), (10), (6), (4), (1)
Pubmed 1 reference available
Catalog no. ABIN182834
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF426
Sequence VMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQG WEMRLETQWS
Predicted Reactivity Human : 100 %
Characteristics This is a rabbit polyclonal antibody against ZNF426. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF426
Background Located on chromosome 19, this gene encodes for zinc finger protein 426.
Molecular Weight 63 kDa
Gene ID 79088
NCBI Accession NM_024106, NP_077011
UniProt Q9BUY5
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 554 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Hosts (22), (1)
Reactivities (23), (15), (15)
Applications (13), (10), (6), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (1), (1), (1)
back to top