Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182834

Zinc Finger Protein 426 (ZNF426) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 2900057C04Rik, KRAB1, Zfo61, Zfp68-rs1, Znf426, mKIAA4237, RGD1564241, Zfp426l2, Znf846, ZNF426, MGC156802
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182834
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF426 antibody: synthetic peptide directed towards the N terminal of human ZNF426
Sequence VMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQG WEMRLETQWS
Predicted Reactivity Human : 100%
Characteristics This is a rabbit polyclonal antibody against ZNF426. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF426
Background Located on chromosome 19, this gene encodes for zinc finger protein 426.
Molecular Weight 63kDa
Gene ID 79088
NCBI Accession NP_077011, NM_024106
UniProt Q9BUY5
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF426 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 426 (ZNF426)", type "Antibodies"
Hosts (22), (1)
Reactivities (23), (13), (13)
Applications (13), (10), (4), (4), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (2), (1), (1), (1), (1), (1)
Beacon