Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182841

Zinc Finger Protein 750 (ZNF750) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ZFP750, A030007D23Rik, Znf750, zgc:110351, ZNF750
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182841
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZINC FINGER PROTEIN 750 antibody: synthetic peptide directed towards the middle region of human ZINC FINGER PROTEIN 750
Sequence NRKHVEFESPIPEAKDSSKAGQRDTEGSKMSPRAGSAATG SPGRPSPTDF
Predicted Reactivity Human :100%,   Bovine :92%,   Mouse :92%,   Chicken :92%,   African clawed frog :92%,   Western clawed frog :92%,  
Characteristics This is a rabbit polyclonal antibody against ZINC FINGER PROTEIN 750. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ZINC FINGER PROTEIN 750
Background Zinc finger protein 750 is a new candidate transcription factor
Molecular Weight 77kDa
Gene ID 79755
NCBI Accession NP_078978, NM_024702
UniProt Q32MQ0
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZINC FINGER PROTEIN 750 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "Zinc Finger Protein 750 (ZNF750)", type "Antibodies"
Hosts (17)
Reactivities (17), (15), (13), (13), (13), (1), (1), (1), (1)
Applications (10), (5), (4), (3), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Beacon