Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182862

Ubiquitin Specific Peptidase 3 (USP3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SIH003, UBP, AA409661, BC017156, fe50h06, wu:fe50h06, USP3
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182862
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-USP3 antibody: synthetic peptide directed towards the N terminal of human USP3
Sequence GRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCS SYSTYCYRCD
Predicted Reactivity Dog : 100%, Human : 100%, Bovine : 92%, Horse : 92%, African clawed frog : 90%, Chicken : 84%, Mouse : 84%, Rat : 84%
Characteristics This is a rabbit polyclonal antibody against USP3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name USP3
Background USP3 is a novel human ubiquitin-specific protease. The USP3 protein is a functional ubiquitin-specific protease in vitro, and is able to inhibit ubiquitin-dependent degradation of both an N-end Rule substrate and abnormal endogenous proteins in yeast. USP3 is also only the second known ubiquitin-specific protease capable of efficiently cleaving a ubiquitin-proline bond.
Molecular Weight 59kDa
Gene ID 9960
NCBI Accession NP_006528, NM_006537
UniProt Q9Y6I4
Research Area Proteolysis / Ubiquitin, Metabolism, Amino Acids
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-USP3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Puente, Sánchez, Overall et al.: "Human and mouse proteases: a comparative genomic approach." in: Nature reviews. Genetics, Vol. 4, Issue 7, pp. 544-58, 2003 (PubMed).

Alternatives for antigen "Ubiquitin Specific Peptidase 3 (USP3)", type "Antibodies"
Hosts (45), (5), (3)
Reactivities (52), (7), (7), (1), (1), (1)
Applications (32), (20), (16), (13), (10), (4), (3), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (5), (4), (2), (2), (2), (2), (1), (1)
Beacon