Did you know that you can buy products from over 140 different suppliers from us?

Ubiquitin Specific Peptidase 3 (USP3) (N-Term) antibody

Details for Product No. ABIN182862
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms SIH003, UBP, AA409661, BC017156, fe50h06, wu:fe50h06, USP3
Epitope
N-Term
(8), (7), (4), (2), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human
(63), (9), (8), (1), (1), (1)
Host
Rabbit
(56), (6), (2)
Clonality
Polyclonal
Conjugate
Un-conjugated
(3), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(42), (27), (15), (14), (10), (4), (4), (4), (2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182862
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human USP3
Sequence GRYVNGHAKKHYEDAQVPLTNHKKSEKQDKVQHTVCMDCS SYSTYCYRCD
Predicted Reactivity Dog : 100 %, Human : 100 %, Bovine : 90 %, Horse : 90 %, African clawed frog : 90 %, Chicken : 80 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against USP3. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name USP3
Background USP3 is a novel human ubiquitin-specific protease. The USP3 protein is a functional ubiquitin-specific protease in vitro, and is able to inhibit ubiquitin-dependent degradation of both an N-end Rule substrate and abnormal endogenous proteins in yeast. USP3 is also only the second known ubiquitin-specific protease capable of efficiently cleaving a ubiquitin-proline bond.
Molecular Weight 59 kDa
Gene ID 9960
NCBI Accession NM_006537, NP_006528
UniProt Q9Y6I4
Research Area Proteolysis / Ubiquitin, Metabolism, Amino Acids
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 520 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Ubiquitin Specific Peptidase 3 (USP3) (N-Term) antibody WB Suggested Anti-USP3 Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Puente, Sánchez, Overall et al.: "Human and mouse proteases: a comparative genomic approach." in: Nature reviews. Genetics, Vol. 4, Issue 7, pp. 544-58, 2003 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182862
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top