Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182877

Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms 5330431N24Rik, AI851877, ARTD11, HIN1L, RGD1561791, C12orf6, fd14a11, wu:fd14a11, zgc:165536, parp11, MGC82612, PARP11
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182877
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-PARP11 antibody: synthetic peptide directed towards the N terminal of human PARP11
Sequence SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYN EVANLFGKTM
Predicted Reactivity Bovine : 100%, Horse : 100%, Human : 100%, Pig : 92%, Rabbit : 92%, Mouse : 90%, Dog : 78%, Rat : 78%
Characteristics This is a rabbit polyclonal antibody against PARP11. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name PARP11
Background The PARP11 gene is part of the poly (ADP-ribose) polymerase family.
Molecular Weight 39kDa
Gene ID 9371
NCBI Accession NP_065100, NM_020367
UniProt Q9NR21
Research Area Chromatin and Nuclear Signaling
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-PARP11 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Puente, Sánchez, Overall et al.: "Human and mouse proteases: a comparative genomic approach." in: Nature reviews. Genetics, Vol. 4, Issue 7, pp. 544-58, 2003 (PubMed).

Alternatives for antigen "Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11)", type "Antibodies"
Hosts (14)
Reactivities (11), (5), (5), (1), (1), (1)
Applications (14), (6)
Epitopes (3), (1), (1), (1), (1)
Beacon