Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11) (N-Term) antibody

Details for Product No. ABIN182878
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms 5330431N24Rik, AI851877, ARTD11, HIN1L, RGD1561791, C12orf6, fd14a11, wu:fd14a11, zgc:165536, parp11, MGC82612, PARP11
Epitope
N-Term
(3), (1), (1), (1), (1)
Reactivity
Human
(13), (8), (8), (2), (2), (1)
Host
Rabbit
(16)
Clonality
Polyclonal
Application
Western Blotting (WB)
(16), (6)
Pubmed 1 reference available
Catalog no. ABIN182878
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human PARP11
Sequence SAFSYICENEAIPMPPHWENVNTQVPYQLIPLHNQTHEYN EVANLFGKTM
Predicted Reactivity Bovine : 100 %, Horse : 100 %, Human : 100 %, Pig : 90 %, Rabbit : 90 %, Mouse : 90 %, Dog : 70 %, Rat : 70 %
Characteristics This is a rabbit polyclonal antibody against PARP11. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name PARP11
Molecular Weight 39 kDa
Gene ID 57097
NCBI Accession NM_020367, NP_065100
UniProt Q9NR21
Research Area Chromatin and Nuclear Signaling
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 331 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11) (N-Term) antibody anti-Poly (ADP-Ribose) Polymerase Family, Member 11 (PARP11) (N-Term) antibody
Background publications Puente, Sánchez, Overall et al.: "Human and mouse proteases: a comparative genomic approach." in: Nature reviews. Genetics, Vol. 4, Issue 7, pp. 544-58, 2003 (PubMed).

Hosts (16)
Reactivities (13), (8), (8), (2), (2), (1)
Applications (16), (6)
Epitopes (3), (1), (1), (1), (1)
back to top