Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182886

Solute Carrier Family 17 (Anion/Sugar Transporter), Member 2 (SLC17A2) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms C730032N17Rik, NPT3, SLC34A1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182886
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SLC17A2 antibody: synthetic peptide directed towards the middle region of human SLC17A2
Sequence VIYDDPMHHPCISVREKEHILSSLAQQPSSPGRAVPIKAM VTCLPLWAIF
Predicted Reactivity Human : 100%, Pig : 91%, Guinea pig : 90%, Mouse : 84%
Characteristics This is a rabbit polyclonal antibody against SLC17A2. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name SLC17A2
Background SLC17A2 is a member of the solute carrier family.
Molecular Weight 48kDa
Gene ID 10246
NCBI Accession NP_005826, NM_005835
UniProt O00624
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SLC17A2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ruddy, Kronmal, Lee et al.: "A 1.1-Mb transcript map of the hereditary hemochromatosis locus." in: Genome research, Vol. 7, Issue 5, pp. 441-56, 1997 (PubMed).

Alternatives for antigen "Solute Carrier Family 17 (Anion/Sugar Transporter), Member 2 (SLC17A2)", type "Antibodies"
Hosts (17)
Reactivities (15), (12), (1)
Applications (16), (10), (3), (2), (1), (1)
Epitopes (7), (2)
Beacon