Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182896

Carboxypeptidase A1 (Pancreatic) (CPA1) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms CPA, Cpa, 0910001L12Rik, CPA1, cpa1, cbpa1
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Rat (Rattus), Mouse (Murine), Pig (Porcine), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182896
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CPA1 antibody: synthetic peptide directed towards the N terminal of human CPA1
Sequence QVLRISVADEAQVQKVKELEDLEHLQLDFWRGPAHPGSPI DVRVPFPSIQ
Predicted Reactivity Pig : 92%, Dog : 85%, Bovine : 83%
Characteristics This is a rabbit polyclonal antibody against CPA1. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CPA1
Background Three different forms of human pancreatic procarboxypeptidase A have been isolated. The A1 and A2 forms are monomeric proteins with different biochemical properties. Carboxypeptidase A1 is a monomeric pancreatic exopeptidase. It is involved in zymogen inhibition.
Molecular Weight 47kDa
Gene ID 1357
NCBI Accession NP_001859, NM_001868
UniProt P15085
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CPA1 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Scherer, Cheung, MacDonald et al.: "Human chromosome 7: DNA sequence and biology." in: Science (New York, N.Y.), Vol. 300, Issue 5620, pp. 767-72, 2003 (PubMed).

Alternatives for antigen "Carboxypeptidase A1 (Pancreatic) (CPA1)", type "Antibodies"
Hosts (56), (11), (1)
Reactivities (43), (38), (19), (16), (13), (12), (12), (12)
Applications (55), (42), (14), (12), (10), (10), (8), (8), (6), (4), (4), (3), (3), (3), (2), (1), (1), (1), (1)
Conjugates (5), (5), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (7), (3), (2), (1), (1)
Beacon