Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182898

Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Asml3b, AU045240, 1110054A24Rik, ASML3B
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182898
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-SMPDL3B antibody: synthetic peptide directed towards the N terminal of human SMPDL3B
Sequence ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTK VYAALGNHDF
Predicted Reactivity Guinea pig : 100%, Human : 100%, Pig : 100%, Horse : 92%, Rabbit : 92%, Bovine : 84%, Chicken : 84%, Dog : 84%, Mouse : 84%, Rat : 84%
Characteristics This is a rabbit polyclonal antibody against SMPDL3B. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Affinity Purified
Alternative Name SMPDL3B
Background Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.
Molecular Weight 52kDa
Gene ID 27293
NCBI Accession NP_055289, NM_014474
UniProt Q92485
Research Area Signaling, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-SMPDL3B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B)", type "Antibodies"
Hosts (8), (5)
Reactivities (12), (2), (1), (1), (1)
Applications (12), (6), (3), (3), (1), (1)
Epitopes (3), (2), (1), (1), (1)
Beacon