Did you know that you can buy products from over 140 different suppliers from us?

Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B) (N-Term) antibody

Details for Product No. ABIN182898
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Asml3b, AU045240, 1110054A24Rik, ASML3B
Epitope
N-Term
(3), (2), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Dog (Canine), Human
(15), (2), (1), (1), (1)
Host
Rabbit
(11), (5)
Clonality
Polyclonal
Application
Immunohistochemistry (IHC), Western Blotting (WB)
(14), (7), (3), (3), (2), (1)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182898
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human SMPDL3B
Sequence ILWTGDDTPHVPDEKLGEAAVLEIVERLTKLIREVFPDTK VYAALGNHDF
Predicted Reactivity Guinea pig : 100 %, Human : 100 %, Pig : 100 %, Horse : 90 %, Rabbit : 90 %, Bovine : 80 %, Chicken : 80 %, Dog : 80 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against SMPDL3B. It was validated on Western Blot and immunohistochemistry.
Purification Affinity Purified
Alternative Name SMPDL3B
Background Located on chromosome 1, this gene encodes for acid sphingomyelinase-like phosphodiesterase 3b precursor protein.
Molecular Weight 52 kDa
Gene ID 27293
NCBI Accession NM_014474, NP_055289
UniProt Q92485
Research Area Signaling, Metabolism
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 463 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B) (N-Term) antibody WB Suggested Anti-SMPDL3B Antibody Titration: 0.2-1 ug/ml
Positive Control: Raji cell lysate
anti-Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B) (N-Term) antibody (2) anti-Sphingomyelin phosphodiesterase, Acid-Like 3B (SMPDL3B) (N-Term) antibody (Image 2)
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182898
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top