Kinesin Family Member 3A (KIF3A) (C-Term) antibody

Details for Product No. ABIN182906
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FLA10, KLP-20, 111-11-71, 111-11-86, AW124694, Kif3, Kifl, Kns3
Epitope
C-Term
(1), (1)
Reactivity
Rabbit, Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
(19), (15), (14), (12), (12), (12), (12)
Host
Rabbit
(19), (1)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (10), (5), (3), (2), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN182906
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the C terminal of human KIF3A
Sequence PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTS KGKARPKTGR
Predicted Reactivity Chicken : 100 %, Dog : 100 %, Guinea pig : 100 %, Horse : 100 %, Human : 100 %, Pig : 100 %, Rabbit : 100 %, Zebrafish : 100 %, African clawed frog : 90 %, Mouse : 90 %, Rat : 90 %
Characteristics This is a rabbit polyclonal antibody against KIF3A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name KIF3A
Background KIF3A/B is a kinesin involved in intraflagellar transport and Golgi trafficking.
Molecular Weight 80 kDa
Gene ID 11127
NCBI Accession NM_007054, NP_008985
UniProt Q9Y496
Research Area Stem Cells, Wnt, Cytoskeleton
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 699 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kinesin Family Member 3A (KIF3A) (C-Term) antibody WB Suggested Anti-KIF3A Antibody Titration: 0.2-1 ug/ml
Positive Control: Jurkat cell lysate
Background publications Whitehead, Wang, Bost-Usinger et al.: "Photoreceptor localization of the KIF3A and KIF3B subunits of the heterotrimeric microtubule motor kinesin II in vertebrate retina." in: Experimental eye research, Vol. 69, Issue 5, pp. 491-503, 1999 (PubMed).

Hosts (19), (1)
Reactivities (19), (15), (14), (12), (12), (12), (12)
Applications (10), (10), (5), (3), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top