Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182906

Kinesin Family Member 3A (KIF3A) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms FLA10, KLP-20, 111-11-71, 111-11-86, AW124694, Kif3, Kifl, Kns3
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Rabbit, Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182906
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-KIF3A antibody: synthetic peptide directed towards the C terminal of human KIF3A
Sequence PVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTS KGKARPKTGR
Predicted Reactivity Chicken : 100%, Dog : 100%, Guinea pig : 100%, Horse : 100%, Human : 100%, Pig : 100%, Rabbit : 100%, Zebrafish : 100%, African clawed frog : 92%, Mouse : 92%, Rat : 92%
Characteristics This is a rabbit polyclonal antibody against KIF3A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name KIF3A
Background KIF3A/B is a kinesin involved in intraflagellar transport and Golgi trafficking.
Molecular Weight 80kDa
Gene ID 11127
NCBI Accession NP_008985, NM_007054
UniProt Q9Y496
Research Area Stem Cells, Cytoskeleton, Wnt Signaling, Wnt
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-KIF3A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Whitehead, Wang, Bost-Usinger et al.: "Photoreceptor localization of the KIF3A and KIF3B subunits of the heterotrimeric microtubule motor kinesin II in vertebrate retina." in: Experimental eye research, Vol. 69, Issue 5, pp. 491-503, 1999 (PubMed).

Alternatives for antigen "Kinesin Family Member 3A (KIF3A)", type "Antibodies"
Hosts (21), (1)
Reactivities (21), (14), (14), (12), (12), (12), (12)
Applications (12), (10), (5), (3), (2), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (4), (2), (1)
Beacon