Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182923

FLJ37300 (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
Reactivity
Mouse (Murine), Rat (Rattus), Cow (Bovine), Xenopus laevis, Zebrafish (Danio rerio), Human
Host
Rabbit
Clonality Polyclonal
Application
Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182923
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-FLJ37300 antibody: synthetic peptide directed towards the N terminal of human FLJ37300
Sequence EVSMSYLEIYNEMIRDLLNPSLGYLELREDSKGVIQVAGI TEVSTINAKE
Predicted Reactivity Bovine :100%,   Human :100% Mouse :92%,   Western clawed frog :92%,   Rat :92%,   African clawed frog :92%,   Red flour beetle :92%,   Starlet sea anemone :85%,   Zebrafish :78%,   Green puffer :78%,  
Characteristics This is a rabbit polyclonal antibody against FLJ37300. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Background FLJ37300 is a hypothetical protein found on chromosome 17.
Molecular Weight 62kDa
Gene ID 124602
NCBI Accession NP_694941, NM_153209
UniProt Q8N1X8
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-FLJ37300 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Beacon