Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182936

REST Corepressor 3 (RCOR3) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms RP11-318L16.1, 4921514E24Rik, C730034D20Rik, E130101E15Rik, RCOR3, si:ch211-284e20.6
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Zebrafish (Danio rerio), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB), Immunohistochemistry (IHC)
Pubmed 1 reference available
Catalog no. ABIN182936
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RCOR3 antibody: synthetic peptide directed towards the N terminal of human RCOR3
Sequence MRVGAEYQARIPEFDPGATKYTDKDNGGMLVWSPYHSIPD AKLDEYIAIA
Predicted Reactivity Bovine : 100%, Dog : 100%, Horse : 100%, Human : 100%, Mouse : 100%, Rat : 100%, Rabbit : 90%, Chicken : 85%, Zebrafish : 78%
Characteristics This is a rabbit polyclonal antibody against RCOR3. It was validated on Western Blot and immunohistochemistry. We manufacture rabbit polyclonal antibodies on a large scale of high throughput manner. Our antibodies are peptide based and protein family oriented.
Purification Protein A purified
Alternative Name RCOR3
Background RCOR3 is a REST corepressor 3 protein located on chromosome 1.
Molecular Weight 56kDa
Gene ID 55758
NCBI Accession NP_060724, NM_018254
UniProt Q9P2K3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RCOR3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Ota, Suzuki, Nishikawa et al.: "Complete sequencing and characterization of 21,243 full-length human cDNAs." in: Nature genetics, Vol. 36, Issue 1, pp. 40-5, 2003 (PubMed).

Alternatives for antigen "REST Corepressor 3 (RCOR3)", type "Antibodies"
Hosts (8)
Reactivities (8), (3), (2), (2), (2), (2)
Applications (6), (4), (2), (1)
Epitopes (4), (1), (1)
Beacon