Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182938

Tryptophan Hydroxylase 2 (TPH2) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms ADHD7, NTPH, Ntph, tphR, wu:fq15a04, AU043594, tph2, tph1l, tphD2
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182938
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-TPH2 antibody: synthetic peptide directed towards the N terminal of human TPH2
Sequence REAATESGKTAVVFSLKNEVGGLVKALRLFQEKRVNMVHI ESRKSRRRSS
Predicted Reactivity Bovine : 100%, Dog : 100%, Human : 100%, Rabbit : 100%, Mouse : 92%, Chicken : 91%, Rat : 91%, Horse : 84%
Characteristics This is a rabbit polyclonal antibody against TPH2. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name TPH2
Background Tryptophan hydroxylase (TPH, EC 1.14.16.4) is the rate-limiting enzyme in the synthesis of serotonin (5-hydroxytryptamine, or 5HT). 5HT is causally involved in numerous central nervous activities, and it has several functions in peripheral tissues, including the maintenance of vascular tone and gut motility.
Molecular Weight 56kDa
Gene ID 121278
NCBI Accession NP_775489, NM_173353
UniProt Q8IWU9
Research Area Neurology, Metabolism
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-TPH2 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Walther, Peter, Bashammakh et al.: "Synthesis of serotonin by a second tryptophan hydroxylase isoform." in: Science (New York, N.Y.), Vol. 299, Issue 5603, pp. 76, 2003 (PubMed).

Alternatives for antigen "Tryptophan Hydroxylase 2 (TPH2)", type "Antibodies"
Hosts (45), (11), (1)
Reactivities (41), (31), (28), (17), (5), (5), (1), (1), (1), (1), (1)
Applications (41), (22), (10), (9), (4), (3), (3), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (10), (8), (7), (2), (2), (2), (2), (1), (1), (1)
Beacon