Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN182966

AT Rich Interactive Domain 3B (BRIGHT-Like) (ARID3B) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BDP, DRIL2, Bdp, Dri2, ARID3B, wu:fc16g09, wu:fc87c02, zgc:158235
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Dog (Canine), Mouse (Murine), Rat (Rattus), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN182966
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ARID3B antibody: synthetic peptide directed towards the N terminal of human ARID3B
Sequence DPRVAPMSNLLPAPGLPPHGQQAKEDHTKDASKASPSVST AGQPNWNLDE
Predicted Reactivity Dog : 100%, Horse : 100%, Human : 100%, Pig : 100%, Bovine : 92%, Guinea pig : 92%, Mouse : 92%, Rat : 91%
Characteristics This is a rabbit polyclonal antibody against ARID3B. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name ARID3B
Background ARID3B is a member of the ARID (AT-rich interaction domain) family of DNA-binding proteins. The protein is homologous with two proteins that bind to the retinoblastoma gene product, and also with the mouse Bright and Drosophila dead ringer proteins. Members of the ARID family have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification. This gene is a member of the ARID (AT-rich interaction domain) family of proteins which bind DNA. It is homologous with two proteins that bind to the retinoblastoma gene product and also with the mouse Bright and Drosophila dead ringer proteins. A pseudogene on chromosome 1p31 also exists for this gene. Other ARID family members have roles in embryonic patterning, cell lineage gene regulation, cell cycle control, transcriptional regulation and possibly in chromatin structure modification.
Molecular Weight 61kDa
Gene ID 10620
NCBI Accession NP_006456, NM_006465
UniProt O95443
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ARID3B antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Kortschak, Tucker, Saint: "ARID proteins come in from the desert." in: Trends in biochemical sciences, Vol. 25, Issue 6, pp. 294-9, 2000 (PubMed).

Alternatives for antigen "AT Rich Interactive Domain 3B (BRIGHT-Like) (ARID3B)", type "Antibodies"
Hosts (28), (1)
Reactivities (29), (14), (14), (14), (2)
Applications (17), (10), (6), (6), (3), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (8), (3), (2), (1)
Beacon