Did you know that you can buy products from over 140 different suppliers from us?

MGC4618 (N-Term) antibody

Details for Product No. ABIN182985
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(1)
Reactivity
Mouse (Murine), Rat (Rattus), Human
(1), (1), (1), (1), (1)
Host
Rabbit
(1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(1)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN182985
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human MGC4618
Sequence QRMLSFSDALLSIIATVMILPVTHTEISPEQQFDRSVQRL LATRIAVYLM
Predicted Reactivity Human, Dog (Canine), Rat (Rattus), Mouse (Murine), Horse (Equine), Guinea Pig
Characteristics This is a rabbit polyclonal antibody against MGC4618. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Background The MGC4618 is a hypothetical protein found in Chromosome 4
Molecular Weight 56 kDa
Gene ID 84286
NCBI Accession NM_032326, NP_115702
UniProt Q9BSA9
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 504 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-MGC4618 (N-Term) antibody anti-MGC4618 (N-Term) antibody
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN182985
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top