Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183012

RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3) (C-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms
A-270G1.2, TIFIA, RGD1305001, AL023001, E130302O19Rik, R75565, TIF-1A, Tif1a, RRN3, DKFZp459B073, CG16938, CG3278, CG5951, Dmel\\CG3278, TIF-IA, Tif-1A, TifIA, dTIF-IA, dyak_GLEANR_13182, DyakGE12956, ... show more
Epitope
»Alternatives C-Term
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183012
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-RRN3 antibody: synthetic peptide directed towards the C terminal of human RRN3
Sequence KKDIVEDEDDDFLKGEVPQNDTVIGITPSSFDTHFRSPSS SVGSPPVLYM
Predicted Reactivity Human : 100%, Dog : 85%, Guinea pig : 85%, Horse : 85%, Mouse : 85%, Rabbit : 85%, Rat : 84%, Bovine : 78%, Chicken : 78%
Characteristics This is a rabbit polyclonal antibody against RRN3. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name RRN3
Background RRN3 is RNA polymerase I-specific transcription initiation factor. Phosphorylation of RRN3 by MAPK cascades links cell signaling with the control of gene expression, namely results in rRNA synthesis in turn cell growth..
Molecular Weight 74kDa
Gene ID 54700
NCBI Accession NP_060897, NM_018427
UniProt Q9NYV6
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-RRN3 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Miller, Panov, Friedrich et al.: "hRRN3 is essential in the SL1-mediated recruitment of RNA Polymerase I to rRNA gene promoters." in: The EMBO journal, Vol. 20, Issue 6, pp. 1373-82, 2001 (PubMed).

Alternatives for antigen "RRN3 RNA Polymerase I Transcription Factor Homolog (S. Cerevisiae) (RRN3)", type "Antibodies"
Hosts (22), (3)
Reactivities (25), (3), (3), (3), (2), (2), (2)
Applications (25), (13), (8), (1), (1)
Epitopes (7), (6), (3), (2), (2), (2), (1), (1), (1), (1)
Beacon