Did you know that you can buy products from over 140 different suppliers from us?

Kelch-Like 28 (Drosophila) (KLHL28) (Middle Region) antibody

Details for Product No. ABIN183038
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BTBD5, 2810440N09Rik, 4122402F11Rik, 4931401E10Rik, Btbd5, MGC166193
Epitope
Middle Region
(8), (7), (2), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
(11), (1)
Host
Rabbit
(12)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(12), (6)
Pubmed 1 reference available
Quantity 100 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Catalog No. ABIN183038
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human BTBD5
Sequence GVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQPVAPM TTTRSCFAAA
Predicted Reactivity Bovine :100 %,   Human :100 %,   Mouse :100 %,   Crab-eating macaque :100 %,   Dog :100 %,   Rat :100 %,   Green puffer :90 %,   Blood fluke :80 %,   Florida lancelet :80 %,   Western clawed frog :70 %,   Chicken :70 %,   Eye worm :70 %,   African clawed frog :70 %,   Filarial nematode worm :70 %,  
Characteristics This is a rabbit polyclonal antibody against BTBD5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name BTBD5
Background BTBD5 is a transcription factor containing BTB (POZ) domain
Molecular Weight 64 kDa
Gene ID 54813
NCBI Accession NM_017658, NP_060128
UniProt Q9NXS3
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 571 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Kelch-Like 28 (Drosophila) (KLHL28) (Middle Region) antibody WB Suggested Anti-BTBD5 Antibody Titration: 1.0ug/ml
ELISA Titer: 1:1562500
Positive Control: HepG2 cell lysate
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN183038
229.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
Did you look for something else?
back to top