Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183038

Kelch-Like 28 (Drosophila) (KLHL28) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms BTBD5, 2810440N09Rik, 4122402F11Rik, 4931401E10Rik, Btbd5, MGC166193
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Xenopus laevis, Human, Chicken
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183038
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-BTBD5 antibody: synthetic peptide directed towards the middle region of human BTBD5
Sequence GVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQPVAPM TTTRSCFAAA
Predicted Reactivity Bovine :100%,   Human :100%,   Mouse :100%,   Crab-eating macaque :100%,   Dog :100%,   Rat :100%,   Green puffer :92%,   Blood fluke :83%,   Florida lancelet :83%,   Western clawed frog :78%,   Chicken :78%,   Eye worm :78%,   African clawed frog :78%,   Filarial nematode worm :78%,  
Characteristics This is a rabbit polyclonal antibody against BTBD5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name BTBD5
Background BTBD5 is a transcription factor containing BTB (POZ) domain
Molecular Weight 64kDa
Gene ID 54813
NCBI Accession NP_060128, NM_017658
UniProt Q9NXS3
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-BTBD5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Strausberg, Feingold, Grouse et al.: "Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 99, Issue 26, pp. 16899-903, 2002 (PubMed).

Alternatives for antigen "Kelch-Like 28 (Drosophila) (KLHL28)", type "Antibodies"
Hosts (6)
Reactivities (5), (1)
Applications (6)
Epitopes (3), (2), (1), (1)
Beacon