Chromobox Homolog 8 (CBX8) (Middle Region) antibody

Details for Product No. ABIN183046
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms PC3, RC1, Pc3, cbx8, MGC147589
Epitope
Middle Region
(6), (4), (4), (2), (2), (1), (1), (1), (1)
Reactivity
Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
(51), (20), (17), (15), (14), (12), (2), (2), (1), (1)
Host
Rabbit
(32), (16), (5)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(43), (19), (11), (10), (7), (4), (2), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN183046
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human CBX8
Sequence QCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGA LDPNGTRVRH
Predicted Reactivity Human : 100 %, Bovine : 90 %, Dog : 90 %, Pig : 90 %, Rabbit : 90 %, Mouse : 80 %, Rat : 80 %
Characteristics This is a rabbit polyclonal antibody against CBX8. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name CBX8
Background CBX8 is one of the proteins homolog to the Polycomb group (PcG) proteins. They assemble to form large multiprotein complexes involved in gene silencing. Evidence suggests that PcG complexes are heterogeneous with respect to both protein composition and specific function.
Molecular Weight 43 kDa
Gene ID 57332
NCBI Accession NM_020649, NP_065700
UniProt Q9HC52
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 389 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromobox Homolog 8 (CBX8) (Middle Region) antibody WB Suggested Anti-CBX8 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: HepG2 cell lysate
Background publications Bárdos, Saurin, Tissot et al.: "HPC3 is a new human polycomb orthologue that interacts and associates with RING1 and Bmi1 and has transcriptional repression properties." in: The Journal of biological chemistry, Vol. 275, Issue 37, pp. 28785-92, 2000 (PubMed).

Hosts (32), (16), (5)
Reactivities (51), (20), (17), (15), (14), (12), (2), (2), (1), (1)
Applications (43), (19), (11), (10), (7), (4), (2), (1), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (6), (4), (4), (2), (2), (1), (1), (1), (1)
back to top