Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183046

Chromobox Homolog 8 (CBX8) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms PC3, RC1, Pc3, cbx8, MGC147589
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Mouse (Murine), Rat (Rattus), Dog (Canine), Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183046
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-CBX8 antibody: synthetic peptide directed towards the middle region of human CBX8
Sequence QCGVTSPSSAEATGKLAVDTFPARVIKHRAAFLEAKGQGA LDPNGTRVRH
Predicted Reactivity Human : 100%, Bovine : 92%, Dog : 92%, Pig : 92%, Rabbit : 92%, Mouse : 85%, Rat : 85%
Characteristics This is a rabbit polyclonal antibody against CBX8. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name CBX8
Background CBX8 is one of the proteins homolog to the Polycomb group (PcG) proteins. They assemble to form large multiprotein complexes involved in gene silencing. Evidence suggests that PcG complexes are heterogeneous with respect to both protein composition and specific function.
Molecular Weight 43kDa
Gene ID 57332
NCBI Accession NP_065700, NM_020649
UniProt Q9HC52
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-CBX8 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Bárdos, Saurin, Tissot et al.: "HPC3 is a new human polycomb orthologue that interacts and associates with RING1 and Bmi1 and has transcriptional repression properties." in: The Journal of biological chemistry, Vol. 275, Issue 37, pp. 28785-92, 2000 (PubMed).

Alternatives for antigen "Chromobox Homolog 8 (CBX8)", type "Antibodies"
Hosts (33), (14), (6)
Reactivities (49), (22), (15), (15), (14), (12), (2), (2), (1)
Applications (43), (17), (11), (10), (5), (2), (2), (2), (1)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (9), (7), (5), (2), (2), (2), (2), (2), (1), (1), (1), (1)
Beacon