Tripartite Motif Containing 14 (TRIM14) (N-Term) antibody

Details for Product No. ABIN183076
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms pub, 5830400N10Rik, TRIM14
Epitope
N-Term
(3), (3), (3), (3)
Reactivity
Human
(15), (2), (2)
Host
Rabbit
(13), (2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(15), (3), (2), (2), (2), (1)
Pubmed 1 reference available
Catalog no. ABIN183076
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human TRIM14
Sequence TELRLLLDEEEALAKKFIDKNTQLTLQVYREQADSCREQL DIMNDLSNRV
Predicted Reactivity Human : 100 %, Bovine : 90 %, Horse : 90 %, Mouse : 90 %, Pig : 90 %, Rat : 90 %, Dog : 80 %, Rabbit : 80 %
Characteristics This is a rabbit polyclonal antibody against TRIM14. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name TRIM14
Background The protein encoded byTRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described.The protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four alternatively spliced transcript variants for this gene have been described.
Molecular Weight 50 kDa
Gene ID 9830
NCBI Accession NM_014788, NP_055603
UniProt Q14142
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 442 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Tripartite Motif Containing 14 (TRIM14) (N-Term) antibody anti-Tripartite Motif Containing 14 (TRIM14) (N-Term) antibody
Background publications Reymond, Meroni, Fantozzi et al.: "The tripartite motif family identifies cell compartments." in: The EMBO journal, Vol. 20, Issue 9, pp. 2140-51, 2001 (PubMed).

Hosts (13), (2)
Reactivities (15), (2), (2)
Applications (15), (3), (2), (2), (2), (1)
Epitopes (3), (3), (3), (3)
back to top