Chromosome 22 Open Reading Frame 31 (C22orf31) (Middle Region) antibody

Details for Product No. ABIN183091
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HS747E2A, bK747E2.1
Epitope
Middle Region
(2), (2), (1)
Reactivity
Cow (Bovine), Human
(19)
Host
Rabbit
(19)
Clonality
Polyclonal
Conjugate
Un-conjugated
(1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application
Western Blotting (WB)
(10), (10), (3), (3)
Pubmed 1 reference available
Catalog no. ABIN183091
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human HS747E2A
Sequence MKATQQARKRNFISSKSKQPAGHRRPAGGIRESKESSKEK KLTVRQDLED
Predicted Reactivity Human :100 % Bovine :90 %,  
Characteristics This is a rabbit polyclonal antibody against HS747E2A. It was validated on Western Blot using a cell lysate as a positive control.
Purification Protein A purified
Alternative Name HS747E2A
Background The gene encoding the hypothetical protein HS747E2A is located on chromosome 22.
Molecular Weight 33 kDa
Gene ID 25770
NCBI Accession NM_015370, NP_056185
UniProt O95567
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 290 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Chromosome 22 Open Reading Frame 31 (C22orf31) (Middle Region) antibody WB Suggested Anti-HS747E2A Antibody Titration: 1.25ug/ml
ELISA Titer: 1:500
Positive Control: HepG2 cell lysate
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Hosts (19)
Reactivities (19)
Applications (10), (10), (3), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top