Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN183091

Chromosome 22 Open Reading Frame 31 (C22orf31) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms HS747E2A, bK747E2.1
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Cow (Bovine), Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Conjugate
»Alternatives Un-conjugated
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN183091
Quantity 100 µg
Price
229.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-HS747E2A antibody: synthetic peptide directed towards the middle region of human HS747E2A
Sequence MKATQQARKRNFISSKSKQPAGHRRPAGGIRESKESSKEK KLTVRQDLED
Predicted Reactivity Human :100% Bovine :92%,  
Characteristics This is a rabbit polyclonal antibody against HS747E2A. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Protein A purified
Alternative Name HS747E2A
Background The gene encoding the hypothetical protein HS747E2A is located on chromosome 22.
Molecular Weight 33kDa
Gene ID 25770
NCBI Accession NP_056185, NM_015370
UniProt O95567
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 100 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-HS747E2A antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Product cited in: Collins, Wright, Edwards et al.: "A genome annotation-driven approach to cloning the human ORFeome." in: Genome biology, Vol. 5, Issue 10, pp. R84, 2004 (PubMed).

Alternatives for antigen "Chromosome 22 Open Reading Frame 31 (C22orf31)", type "Antibodies"
Hosts (19)
Reactivities (19)
Applications (10), (10), (5), (3)
Conjugates (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Epitopes (2), (2), (1)
Beacon